Protein
MIA_04009_1
Length
244 amino acids
Browser: contig05:487160-487895-
Protein function
| EGGNOG: | 0PMAH | NOP16 | Involved in the biogenesis of the 60S ribosomal subunit (By similarity) |
|---|---|---|---|
| SGD closest match: | S000000804 | NOP16 | Nucleolar protein 16 |
| CGD closest match: | CAL0000180616 | NOP16 | Nucleolar protein 16 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02205_1 | 56.57% | 251 | 2e-69 | MCA_02205_1 |
| A0A0J9X364_GEOCN | 42.75% | 255 | 3e-40 | Similar to Saccharomyces cerevisiae YER002W NOP16 Constituent of 66S pre-ribosomal particles OS=Geotrichum candidum GN=BN980_GECA01s09404g PE=4 SV=1 |
| UniRef50_A0A0J9X364 | 42.75% | 255 | 7e-37 | Similar to Saccharomyces cerevisiae YER002W NOP16 Constituent of 66S pre-ribosomal particles n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X364_GEOCN |
| A0A1E3PJT1_9ASCO | 35.42% | 240 | 7e-35 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_25737 PE=4 SV=1 |
| A0A167E228_9ASCO | 37.76% | 241 | 4e-32 | Nop16p OS=Sugiyamaella lignohabitans GN=NOP16 PE=4 SV=1 |
| NOP16_CANAL | 36.86% | 236 | 5e-32 | Nucleolar protein 16 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NOP16 PE=3 SV=2 |
| A0A060T525_BLAAD | 38.11% | 244 | 7e-32 | ARAD1C08382p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C08382g PE=4 SV=1 |
| A0A1E4TLL7_9ASCO | 36.63% | 243 | 5e-25 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_147638 PE=4 SV=1 |
| NOP16_YEAST | 34.80% | 250 | 9e-23 | Nucleolar protein 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP16 PE=1 SV=1 |
| NOP16_YARLI | 32.44% | 262 | 3e-22 | Nucleolar protein 16 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NOP16 PE=3 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9511
Predicted cleavage: 31
Protein family membership
- Ribosome biogenesis protein Nop16 (IPR019002)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_04009_1 MPSGVRRKAAMKAGRDVTHNRKQIKRAARKRTREEQVKQYIRRNPILADQWDPKKTMAQKYDFFKKKNLICIRMLTDHCS YQILGLARKIGGYTGGEEKKFYTDKEKDEMEELERLKNEKKEDVLEAGEARIERDEDGNVVKIVYGTAAESDDDDEDKEI GNAIEEDENQPEGLRRLIELSKQEEEKKGREQSEREQDWIADLVAKHGDDYEAMKWDKKLNIYQQSVGDLRKRVTKWKKT QGKN
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.