Protein
MCA_02205_1
Length
232 amino acids
Gene name: NOP16
Description: Nucleolar protein 16; involved in 60S ribosomal subunit biogenesis
Browser: contigB:584010-584774-
RNA-seq: read pairs 905, FPKM 48.0, percentile rank 64.5% (100% = highest expression)
Protein function
| Annotation: | NOP16 | Nucleolar protein 16; involved in 60S ribosomal subunit biogenesis | |
|---|---|---|---|
| KEGG: | K14839 | NOP16 | nucleolar protein 16 |
| EGGNOG: | 0PMAH | NOP16 | Involved in the biogenesis of the 60S ribosomal subunit (By similarity) |
| SGD closest match: | S000000804 | NOP16 | Nucleolar protein 16 |
| CGD closest match: | CAL0000180616 | NOP16 | Nucleolar protein 16 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04009_1 | 56.97% | 251 | 7e-68 | MIA_04009_1 |
| NOP16_CANAL | 41.43% | 210 | 2e-39 | Nucleolar protein 16 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NOP16 PE=3 SV=2 |
| A0A0J9X364_GEOCN | 40.68% | 236 | 4e-36 | Similar to Saccharomyces cerevisiae YER002W NOP16 Constituent of 66S pre-ribosomal particles OS=Geotrichum candidum GN=BN980_GECA01s09404g PE=4 SV=1 |
| UniRef50_A0A0J9X364 | 40.68% | 236 | 8e-33 | Similar to Saccharomyces cerevisiae YER002W NOP16 Constituent of 66S pre-ribosomal particles n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X364_GEOCN |
| A0A167E228_9ASCO | 40.71% | 226 | 2e-35 | Nop16p OS=Sugiyamaella lignohabitans GN=NOP16 PE=4 SV=1 |
| NOP16_YEAST | 41.04% | 212 | 2e-31 | Nucleolar protein 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP16 PE=1 SV=1 |
| A0A1E3PJT1_9ASCO | 37.83% | 230 | 8e-32 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_25737 PE=4 SV=1 |
| A0A060T525_BLAAD | 35.53% | 228 | 1e-29 | ARAD1C08382p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C08382g PE=4 SV=1 |
| A0A1E4TLL7_9ASCO | 35.78% | 218 | 7e-26 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_147638 PE=4 SV=1 |
| NOP16_YARLI | 36.55% | 249 | 1e-21 | Nucleolar protein 16 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NOP16 PE=3 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9691
Predicted cleavage: 17
Protein family membership
- Ribosome biogenesis protein Nop16 (IPR019002)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_02205_1 MPSGVRRRAARKAGRDVTHERKQIKKAAKKRTREEQVRKYIRKNPILAKEWDPKDTMARNYKRLGLARTLGRPTGGEEKQ FLNDEEKEEQERLRKEKEERLKAKKSKNPEAYLEPGEARIIRDDEGNVVKVIYGKEKHYDSDESEEEDSDDDEDQPEGLK KLIELSKIPEVKYERHQTEAEQDWIRRLVEKHGDDYEAMKWDTKLNIYQQSAGDIKKRVLRWKKQQEKINKN
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.