Protein
MIA_02001_1
Length
131 amino acids
Browser: contig02:2320449-2320923-
Protein function
| EGGNOG: | 0PPVD | FG10822.1 | prefoldin subunit 4 |
|---|---|---|---|
| SGD closest match: | S000005097 | GIM3 | Prefoldin subunit 4 |
| CGD closest match: | CAL0000198712 | orf19.1273 | Prefoldin subunit 4 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02507_1 | 59.848% | 132 | 4.00e-41 | MCA_02507_1 |
| A0A0J9X691_GEOCN | 57.252% | 131 | 1.58e-33 | Prefoldin subunit 4 OS=Geotrichum candidum GN=BN980_GECA03s05686g PE=3 SV=1 |
| A0A1E3PRY0_9ASCO | 53.077% | 130 | 5.97e-32 | Prefoldin subunit 4 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48698 PE=3 SV=1 |
| A0A060T987_BLAAD | 48.462% | 130 | 3.05e-29 | Prefoldin subunit 4 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C42064g PE=3 SV=1 |
| UniRef50_A0A163KJY8 | 46.154% | 130 | 2.73e-24 | Prefoldin subunit 4 n=20 Tax=Fungi TaxID=4751 RepID=A0A163KJY8_ABSGL |
| PFD4_YEAST | 41.538% | 130 | 1.21e-21 | Prefoldin subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIM3 PE=1 SV=1 |
| Q6CI49_YARLI | 44.068% | 118 | 1.83e-21 | Prefoldin subunit 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A01738g PE=3 SV=1 |
| Q5A435_CANAL | 40.769% | 130 | 3.53e-20 | Prefoldin subunit 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1273 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0036
Protein family membership
- Prefoldin beta-like (IPR002777)
- Prefoldin, subunit 4 (IPR016661)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01920 (Prefoldin_2)
-
-
-
PIRSF016477 (Prefol...)
-
no IPR
Unintegrated signatures
-
-
-
SSF46579 (Prefoldin)
Protein sequence
>MIA_02001_1 MQMLPADHKPNPEIEVLWEDQERINTFSKLNSRISVLRNSLKSHEQEKEYLSDVEMELELLDEDDEIQYKIGEAFIYLSQ EEALERLQRDTEKVDKLIQEEEEQIGKTAQQMTALKGLLYGKFGNAINLEA
GO term prediction
Biological Process
GO:0006457 protein folding
Molecular Function
GO:0051082 unfolded protein binding
Cellular Component
GO:0016272 prefoldin complex