Protein
MCA_02507_1
Length
132 amino acids
Browser: contigB:1503252-1503922-
RNA-seq: read pairs 725, FPKM 67.4, percentile rank 71.7% (100% = highest expression)
Protein function
| KEGG: | K09550 | PFDN4 | prefoldin subunit 4 |
|---|---|---|---|
| EGGNOG: | 0PPVD | FG10822.1 | prefoldin subunit 4 |
| SGD closest match: | S000005097 | GIM3 | Prefoldin subunit 4 |
| CGD closest match: | CAL0000198712 | orf19.1273 | Prefoldin subunit 4 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02001_1 | 59.85% | 132 | 6e-39 | MIA_02001_1 |
| A0A0J9X691_GEOCN | 59.09% | 132 | 8e-35 | Prefoldin subunit 4 OS=Geotrichum candidum GN=BN980_GECA03s05686g PE=3 SV=1 |
| UniRef50_A0A1X6NBB0 | 48.85% | 131 | 1e-29 | Uncharacterized protein n=1 Tax=Postia placenta MAD-698-R-SB12 TaxID=670580 RepID=A0A1X6NBB0_9APHY |
| A0A060T987_BLAAD | 50.38% | 131 | 2e-32 | Prefoldin subunit 4 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C42064g PE=3 SV=1 |
| A0A1E3PRY0_9ASCO | 50.38% | 131 | 6e-30 | Prefoldin subunit 4 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48698 PE=3 SV=1 |
| Q6CI49_YARLI | 48.28% | 116 | 4e-27 | Prefoldin subunit 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A01738g PE=3 SV=1 |
| PFD4_YEAST | 45.04% | 131 | 8e-27 | Prefoldin subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIM3 PE=1 SV=1 |
| Q5A435_CANAL | 38.17% | 131 | 2e-23 | Prefoldin subunit 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1273 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0138
Protein family membership
- Prefoldin beta-like (IPR002777)
- Prefoldin, subunit 4 (IPR016661)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01920 (Prefoldin_2)
-
-
-
PIRSF016477 (Prefol...)
-
no IPR
Unintegrated signatures
-
-
-
SSF46579 (Prefoldin)
Protein sequence
>MCA_02507_1 MQMLPPDHSKPEAQQEVLWEDQERINTFSKLNNRITNLKEELKKQQEEQEYISDVQMELELVDEDEFVQYKIGEVFVSIR QEEAMERLEKESERLKDSISEYESKIEDIEYEMKTLKGLLYGKFGKTINLES
GO term prediction
Biological Process
GO:0006457 protein folding
Molecular Function
GO:0051082 unfolded protein binding
Cellular Component
GO:0016272 prefoldin complex