Protein

MIA_06402_1

Length
150 amino acids


Browser: contig11:360600-361278-

Protein function

EGGNOG:0PIWKRPS1540s ribosomal protein s15
SGD closest match:S000005400RPS1540S ribosomal protein S15
CGD closest match:CAL0000179139RPS15Ribosomal 40S subunit protein S15

Protein alignments

%idAln lengthE-value
MCA_06278_184.667%1501.17e-66MCA_06278_1
A0A0J9XJ33_GEOCN80.667%1505.68e-66Similar to Saccharomyces cerevisiae YOL040C RPS15 Protein component of the small (40S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA20s00472g PE=3 SV=1
UniRef50_A0A0G4MMI767.333%1502.71e-49Uncharacterized protein n=3 Tax=Verticillium longisporum TaxID=100787 RepID=A0A0G4MMI7_9PEZI
A0A060THW2_BLAAD68.000%1509.71e-54ARAD1D34540p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D34540g PE=3 SV=1
A0A1E3PN50_9ASCO72.993%1371.59e-51Ribosomal protein S19 (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_22990 PE=3 SV=1
Q6C2R3_YARLI69.655%1452.73e-50YALI0F05803p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F05803g PE=3 SV=1
A0A1E4TGT4_9ASCO60.265%1514.41e-50Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_114212 PE=3 SV=1
A0A1D8PK22_CANAL64.234%1373.46e-45Ribosomal 40S subunit protein S15 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS15 PE=3 SV=1
RS15_YEAST64.964%1379.69e-4540S ribosomal protein S15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS15 PE=1 SV=1
A0A161HM86_9ASCO74.667%753.08e-37Ribosomal 40S subunit protein S15 OS=Sugiyamaella lignohabitans GN=RPS15 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0405

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 150

Detailed signature matches

    1. MF_00531 (Ribosomal...)
    2. PIRSF002144 (RPS19p...)
    3. PF00203 (Ribosomal_S19)
    4. PR00975 (RIBOSOMALS19)
    1. SSF54570 (Ribosomal...)
    1. PS00323 (RIBOSOMAL_S19)

Protein sequence

>MIA_06402_1
MSDANDQSREEQRKKRVLKKFSYRGIDLPDLLKLDIQGFSEVVHARARRRLNRGLNKKPMGLIKKLRAAKKAAGNEKPAP
VKTHLRNMIIVPEMIGSALGVYNGKQFFLVEVKPEMVGHYLGEFSITYTPTRHGRPGIGATHTARFIPLA

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005840 ribosome
GO:0015935 small ribosomal subunit