Protein
MCA_06278_1
Length
149 amino acids
Gene name: RPS15
Description: 40S ribosomal protein S15
Browser: contigD:3746287-3747043-
RNA-seq: read pairs 48860, FPKM 4024.8, percentile rank 99.1% (100% = highest expression)
Protein function
Annotation: | RPS15 | 40S ribosomal protein S15 | |
---|---|---|---|
KEGG: | K02958 | RP-S15e | small subunit ribosomal protein S15e |
EGGNOG: | 0PIWK | RPS15 | 40s ribosomal protein s15 |
SGD closest match: | S000005400 | RPS15 | 40S ribosomal protein S15 |
CGD closest match: | CAL0000179139 | RPS15 | Ribosomal 40S subunit protein S15 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XCA8_GEOCN | 82.44% | 131 | 7e-53 | Similar to Saccharomyces cerevisiae YOL040c RPS15 Protein component of the small (40S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA09s00274g PE=3 SV=1 |
MIA_06402_1 | 80.95% | 147 | 2e-52 | MIA_06402_1 |
UniRef50_F7VKK5 | 64.47% | 152 | 3e-41 | WGS project CABT00000000 data, contig 2.1 n=83 Tax=cellular organisms TaxID=131567 RepID=F7VKK5_SORMK |
A0A1E3PN50_9ASCO | 70.99% | 131 | 5e-42 | Ribosomal protein S19 (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_22990 PE=3 SV=1 |
A0A1E4TGT4_9ASCO | 66.41% | 131 | 1e-41 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_114212 PE=3 SV=1 |
A0A060THW2_BLAAD | 64.24% | 151 | 6e-40 | ARAD1D34540p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D34540g PE=3 SV=1 |
Q6C2R3_YARLI | 70.99% | 131 | 2e-39 | YALI0F05803p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F05803g PE=3 SV=1 |
A0A1D8PK22_CANAL | 64.89% | 131 | 5e-39 | Ribosomal 40S subunit protein S15 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS15 PE=3 SV=1 |
RS15_YEAST | 66.92% | 130 | 8e-37 | 40S ribosomal protein S15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS15 PE=1 SV=1 |
A0A161HM86_9ASCO | 71.43% | 70 | 7e-32 | Ribosomal 40S subunit protein S15 OS=Sugiyamaella lignohabitans GN=RPS15 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.3538
Protein family membership
- Ribosomal protein S19/S15 (IPR002222)
- Ribosomal protein S19A/S15e (IPR005713)
Domains and repeats
-
Domain
1
20
40
60
80
100
120
149
Detailed signature matches

Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MCA_06278_1 MSDEQNREELRKKRTLKKFSYRGVDLEDLLKLDINEFSEIVHARARRRLNRGLNKKPMGLIKKLRAAKKAAPPNEKPAYV KTHLRNMIIVPEMIGSQLGVYNGKHFYALDVKPEMVGHYLGEMSITYTPTRHGRPGTGATHTSRFIPLK
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit