Protein

MIA_06398_1

Length
154 amino acids


Browser: contig11:351392-351926-

Protein function

EGGNOG:0PPWGCOX16cytochrome c oxidase assembly protein cox-16
SGD closest match:S000003540COX16Cytochrome c oxidase assembly protein COX16, mitochondrial
CGD closest match:CAL0000184804COX16Cytochrome c oxidase assembly protein COX16, mitochondrial

Protein alignments

%idAln lengthE-value
MCA_01414_165.854%1231.12e-57MCA_01414_1
A0A0J9XIV3_GEOCN62.698%1262.21e-56Similar to Saccharomyces cerevisiae YJL003W COX16 Mitochondrial inner membrane protein, required for assembly of cytochrome c oxidase OS=Geotrichum candidum GN=BN980_GECA22s01022g PE=4 SV=1
COX16_YARLI54.386%1144.76e-42Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COX16 PE=3 SV=1
A0A1E3PI10_9ASCO52.632%1143.27e-39Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_59142 PE=4 SV=1
A0A060T3A2_BLAAD53.782%1197.09e-39ARAD1A08052p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A08052g PE=4 SV=1
COX16_YEAST49.580%1198.58e-36Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX16 PE=1 SV=1
UniRef50_P4708149.580%1192.05e-32Cytochrome c oxidase assembly protein COX16, mitochondrial n=30 Tax=Saccharomycetales TaxID=4892 RepID=COX16_YEAST
A0A1E4TJU3_9ASCO49.565%1153.36e-33Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_23832 PE=4 SV=1
COX16_CANAL41.935%1245.43e-25Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX16 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.4618
Predicted cleavage: 34

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)
  2. mobidb-lite (disord...)

Protein sequence

>MIA_06398_1
MIPTLTKLASFSNKRYMSPKQFETWKKTPYGRYSTQLKKHPFLLFGLPFMASLFFASLYLSEFTSIRYQNRDERVQMITE
EEALKSSNANRRKVDMRQEFYRLQQLGDLDDWEQVRVPRLSNESENVWDVSGPASPDNSAAAAAVAADKLKKNQ

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

GO:0031966 mitochondrial membrane