Protein
MCA_01414_1
Length
128 amino acids
Gene name: COX16
Description: Cytochrome c oxidase assembly protein COX16, mitochondrial
Browser: contigA:4397171-4397615+
RNA-seq: read pairs 1592, FPKM 152.5, percentile rank 85.1% (100% = highest expression)
Protein function
| Annotation: | COX16 | Cytochrome c oxidase assembly protein COX16, mitochondrial | |
|---|---|---|---|
| KEGG: | K18182 | COX16 | cytochrome c oxidase assembly protein subunit 16 |
| EGGNOG: | 0PPWG | COX16 | cytochrome c oxidase assembly protein cox-16 |
| SGD closest match: | S000003540 | COX16 | Cytochrome c oxidase assembly protein COX16, mitochondrial |
| CGD closest match: | CAL0000184804 | COX16 | Cytochrome c oxidase assembly protein COX16, mitochondrial |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XIV3_GEOCN | 68.97% | 116 | 3e-52 | Similar to Saccharomyces cerevisiae YJL003W COX16 Mitochondrial inner membrane protein, required for assembly of cytochrome c oxidase OS=Geotrichum candidum GN=BN980_GECA22s01022g PE=4 SV=1 |
| MIA_06398_1 | 67.54% | 114 | 1e-51 | MIA_06398_1 |
| A0A1E3PI10_9ASCO | 56.73% | 104 | 4e-37 | Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_59142 PE=4 SV=1 |
| COX16_YARLI | 52.78% | 108 | 4e-36 | Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COX16 PE=3 SV=1 |
| A0A1E4TJU3_9ASCO | 52.73% | 110 | 9e-35 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_23832 PE=4 SV=1 |
| A0A060T3A2_BLAAD | 51.89% | 106 | 1e-34 | ARAD1A08052p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A08052g PE=4 SV=1 |
| UniRef50_D5GPX2 | 45.05% | 111 | 5e-26 | Uncharacterized protein n=10 Tax=Fungi TaxID=4751 RepID=D5GPX2_TUBMM |
| COX16_YEAST | 46.79% | 109 | 1e-28 | Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX16 PE=1 SV=1 |
| COX16_CANAL | 44.07% | 118 | 5e-27 | Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX16 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0405
Predicted cleavage: 27
Protein family membership
- Cytochrome c oxidase assembly protein COX16 (IPR020164)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_01414_1 MPSLGNKKYMSPKQYAEWQKTWYGRYSTALKKHHFLLFGLPFFATLFFGSIYLSEFTQVKYTNYDNKVRMMDEEEALSIG RNKRKVNMKDEFYRLQQLGNLDNWEQVRVPRKSPEEENIWEIKNNNGK
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0031966 mitochondrial membrane