MCA_01414_1

Gene name: COX16

Description: Cytochrome c oxidase assembly protein COX16, mitochondrial

Browser: contigA:4397171-4397615+

RNA-seq: read pairs 1592, FPKM 152.5, percentile rank 85.1% (100% = highest expression)

Protein function

Annotation:		COX16	Cytochrome c oxidase assembly protein COX16, mitochondrial
KEGG:	K18182	COX16	cytochrome c oxidase assembly protein subunit 16
EGGNOG:	0PPWG	COX16	cytochrome c oxidase assembly protein cox-16
SGD closest match:	S000003540	COX16	Cytochrome c oxidase assembly protein COX16, mitochondrial
CGD closest match:	CAL0000184804	COX16	Cytochrome c oxidase assembly protein COX16, mitochondrial

Protein alignments

	%id	Aln length	E-value
A0A0J9XIV3_GEOCN	68.97%	116	3e-52	Similar to Saccharomyces cerevisiae YJL003W COX16 Mitochondrial inner membrane protein, required for assembly of cytochrome c oxidase OS=Geotrichum candidum GN=BN980_GECA22s01022g PE=4 SV=1
MIA_06398_1	67.54%	114	1e-51	MIA_06398_1
A0A1E3PI10_9ASCO	56.73%	104	4e-37	Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_59142 PE=4 SV=1
COX16_YARLI	52.78%	108	4e-36	Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COX16 PE=3 SV=1
A0A1E4TJU3_9ASCO	52.73%	110	9e-35	Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_23832 PE=4 SV=1
A0A060T3A2_BLAAD	51.89%	106	1e-34	ARAD1A08052p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A08052g PE=4 SV=1
UniRef50_D5GPX2	45.05%	111	5e-26	Uncharacterized protein n=10 Tax=Fungi TaxID=4751 RepID=D5GPX2_TUBMM
COX16_YEAST	46.79%	109	1e-28	Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX16 PE=1 SV=1
COX16_CANAL	44.07%	118	5e-27	Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX16 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0405
Predicted cleavage: 27

Protein family membership

Domains and repeats

Detailed signature matches

Protein sequence

>MCA_01414_1
MPSLGNKKYMSPKQYAEWQKTWYGRYSTALKKHHFLLFGLPFFATLFFGSIYLSEFTQVKYTNYDNKVRMMDEEEALSIG
RNKRKVNMKDEFYRLQQLGNLDNWEQVRVPRKSPEEENIWEIKNNNGK

GO term prediction