Protein

MIA_06389_1

Length
333 amino acids


Browser: contig11:329156-330158-

Protein function

EGGNOG:0PG32FG06963.1type 2A phosphatase activator tip41
SGD closest match:S000006244TIP41Type 2A phosphatase activator TIP41
CGD closest match:CAL0000185540TIP41Tip41p

Protein alignments

%idAln lengthE-value
MCA_05863_157.100%3312.84e-116MCA_05863_1
A0A0J9X571_GEOCN51.916%2873.27e-85Similar to Saccharomyces cerevisiae YPR040W TIP41 Protein that interacts physically and genetically with Tap42p, which regulates protein phosphatase 2A, component of the TOR signaling pathway OS=Geotrichum candidum GN=BN980_GECA03s04102g PE=4 SV=1
UniRef50_A0A0J9X57151.916%2876.70e-82Similar to Saccharomyces cerevisiae YPR040W TIP41 Protein that interacts physically and genetically with Tap42p, which regulates protein phosphatase 2A, component of the TOR signaling pathway n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X571_GEOCN
A0A167C2N3_9ASCO48.727%2756.24e-76Tip41p OS=Sugiyamaella lignohabitans GN=TIP41 PE=4 SV=1
A0A1E3PP71_9ASCO47.826%2761.33e-75TIP41-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_22383 PE=4 SV=1
A0A060T6H7_BLAAD47.619%2731.40e-70ARAD1B18656p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B18656g PE=4 SV=1
Q6CAZ7_YARLI48.529%2721.74e-64YALI0C23100p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C23100g PE=4 SV=1
A0A1D8PNZ9_CANAL39.322%2951.61e-52Tip41p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIP41 PE=4 SV=1
A0A1E4TCG3_9ASCO39.706%2722.21e-52Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4025 PE=4 SV=1
TIP41_YEAST39.262%2983.39e-45Type 2A phosphatase activator TIP41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIP41 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0447
Predicted cleavage: 27

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF04176 (TIP41)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_06389_1
MNNRYAKVPLPATGVPKEHKIHGWRIKTVRNPILSSVEIDAATDKLQIPMPEMIFGNNYIEIAYLGPTEQNSPYWTLRFD
TLNALDRVDKTGTHNELVQVAHSKAWQKSSEKTAQECPDEIHGILKPFDWTYTTDYRGDVSSLTPEHALQEVTVDTHGEA
VFDEHAVPFDKLKKPEPIEFYDEVVLYEDELGDNGIVSLSVKVRVMPHRLLLLARLFLRVDGVLFRVRDTRVYIDFDYQD
SGAPRVIREYTEHEDTYDSVRRKIPRAARDYSMYLRDENWVAAHTPVTKFIREYSHLKEKDEEKVGEKAEEKVGEKAEKK
VGEKVEEKSEEKS

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.