Protein

MCA_05863_1

Length
342 amino acids


Browser: contigD:2579151-2580180+

RNA-seq: read pairs 697, FPKM 25.1, percentile rank 47.7% (100% = highest expression)

Protein function

KEGG:K17607TIPRL type 2A phosphatase activator TIP41
EGGNOG:0PG32FG06963.1type 2A phosphatase activator tip41
SGD closest match:S000006244TIP41Type 2A phosphatase activator TIP41
CGD closest match:CAL0000185540TIP41Tip41p

Protein alignments

%idAln lengthE-value
MIA_06389_156.97%3304e-114MIA_06389_1
A0A0J9X571_GEOCN45.17%3211e-81Similar to Saccharomyces cerevisiae YPR040W TIP41 Protein that interacts physically and genetically with Tap42p, which regulates protein phosphatase 2A, component of the TOR signaling pathway OS=Geotrichum candidum GN=BN980_GECA03s04102g PE=4 SV=1
UniRef50_A0A0J9X57145.17%3212e-78Similar to Saccharomyces cerevisiae YPR040W TIP41 Protein that interacts physically and genetically with Tap42p, which regulates protein phosphatase 2A, component of the TOR signaling pathway n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X571_GEOCN
A0A167C2N3_9ASCO43.95%3142e-75Tip41p OS=Sugiyamaella lignohabitans GN=TIP41 PE=4 SV=1
A0A060T6H7_BLAAD41.69%3193e-72ARAD1B18656p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B18656g PE=4 SV=1
A0A1E3PP71_9ASCO39.69%3258e-63TIP41-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_22383 PE=4 SV=1
Q6CAZ7_YARLI40.69%3171e-54YALI0C23100p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C23100g PE=4 SV=1
A0A1E4TCG3_9ASCO34.39%3146e-53Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4025 PE=4 SV=1
A0A1D8PNZ9_CANAL34.37%3232e-38Tip41p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIP41 PE=4 SV=1
TIP41_YEAST34.35%3293e-38Type 2A phosphatase activator TIP41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIP41 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0118

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF04176 (TIP41)

Protein sequence

>MCA_05863_1
MVNKVPFPSTGEPRHYHIKGWSITTVRAPIYSSPEIDAATAKLKIPMPEMIFGNNYVEIAYSPSSKSHILENSSSSNSDS
NPCWKLRFDTLSALDLVDKTGSSNGGLLQVAHSKAWQKSSEKTKLECPDEILGIVKPYDWTYSTNYKGDEILPKSSPTPP
KDLSESVPATKGLTVVDKDNSAPGNYEKYAIPFHKLQTREPILFFDEVMLYEDELGDNGIVAYTVKIRVMKERLYILTRM
FLRVDGVVFRVRDTRVYVEFKSDITESQDATNGDQKFKKTKRPLVIREYTEKEGSYDSVRSKVPRTARDYSTYLRDDNWI
SQHITVTKTVREYLTDLPPYNS

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.