Protein
MCA_05863_1
Length
342 amino acids
Browser: contigD:2579151-2580180+
RNA-seq: read pairs 697, FPKM 25.1, percentile rank 47.7% (100% = highest expression)
Protein function
| KEGG: | K17607 | TIPRL | type 2A phosphatase activator TIP41 |
|---|---|---|---|
| EGGNOG: | 0PG32 | FG06963.1 | type 2A phosphatase activator tip41 |
| SGD closest match: | S000006244 | TIP41 | Type 2A phosphatase activator TIP41 |
| CGD closest match: | CAL0000185540 | TIP41 | Tip41p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_06389_1 | 56.97% | 330 | 4e-114 | MIA_06389_1 |
| A0A0J9X571_GEOCN | 45.17% | 321 | 1e-81 | Similar to Saccharomyces cerevisiae YPR040W TIP41 Protein that interacts physically and genetically with Tap42p, which regulates protein phosphatase 2A, component of the TOR signaling pathway OS=Geotrichum candidum GN=BN980_GECA03s04102g PE=4 SV=1 |
| UniRef50_A0A0J9X571 | 45.17% | 321 | 2e-78 | Similar to Saccharomyces cerevisiae YPR040W TIP41 Protein that interacts physically and genetically with Tap42p, which regulates protein phosphatase 2A, component of the TOR signaling pathway n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X571_GEOCN |
| A0A167C2N3_9ASCO | 43.95% | 314 | 2e-75 | Tip41p OS=Sugiyamaella lignohabitans GN=TIP41 PE=4 SV=1 |
| A0A060T6H7_BLAAD | 41.69% | 319 | 3e-72 | ARAD1B18656p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B18656g PE=4 SV=1 |
| A0A1E3PP71_9ASCO | 39.69% | 325 | 8e-63 | TIP41-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_22383 PE=4 SV=1 |
| Q6CAZ7_YARLI | 40.69% | 317 | 1e-54 | YALI0C23100p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C23100g PE=4 SV=1 |
| A0A1E4TCG3_9ASCO | 34.39% | 314 | 6e-53 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4025 PE=4 SV=1 |
| A0A1D8PNZ9_CANAL | 34.37% | 323 | 2e-38 | Tip41p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIP41 PE=4 SV=1 |
| TIP41_YEAST | 34.35% | 329 | 3e-38 | Type 2A phosphatase activator TIP41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIP41 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0118
Protein family membership
- TIP41-like protein (IPR007303)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF04176 (TIP41)
-
Protein sequence
>MCA_05863_1 MVNKVPFPSTGEPRHYHIKGWSITTVRAPIYSSPEIDAATAKLKIPMPEMIFGNNYVEIAYSPSSKSHILENSSSSNSDS NPCWKLRFDTLSALDLVDKTGSSNGGLLQVAHSKAWQKSSEKTKLECPDEILGIVKPYDWTYSTNYKGDEILPKSSPTPP KDLSESVPATKGLTVVDKDNSAPGNYEKYAIPFHKLQTREPILFFDEVMLYEDELGDNGIVAYTVKIRVMKERLYILTRM FLRVDGVVFRVRDTRVYVEFKSDITESQDATNGDQKFKKTKRPLVIREYTEKEGSYDSVRSKVPRTARDYSTYLRDDNWI SQHITVTKTVREYLTDLPPYNS
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.