Protein

MIA_06335_1

Length
225 amino acids


Browser: contig11:111367-112340-

Protein function

EGGNOG:0PHM4ribosomal protein L19
SGD closest match:S000002156RPL19A60S ribosomal protein L19-A
CGD closest match:CAL0000180894RPL19ARibosomal protein L19

Protein alignments

%idAln lengthE-value
Q6C4N4_YARLI72.662%1391.15e-58YALI0E25025p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E25025g PE=3 SV=1
MCA_01968_278.723%1881.09e-57MCA_01968_2
A0A0J9X8S8_GEOCN75.532%1887.55e-57Ribosomal protein L19 OS=Geotrichum candidum GN=BN980_GECA05s03937g PE=3 SV=1
A0A1D8PK40_CANAL72.662%1396.92e-53Ribosomal protein L19 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL19A PE=3 SV=1
UniRef50_A0A016X3B164.029%1393.70e-48Ribosomal protein L19 n=45 Tax=Opisthokonta TaxID=33154 RepID=A0A016X3B1_9BILA
RL19A_YEAST69.065%1396.11e-5160S ribosomal protein L19-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL19A PE=1 SV=1
A0A060TA60_BLAAD71.942%1394.11e-47ARAD1D16632p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D16632g PE=3 SV=1
A0A1E4TG62_9ASCO64.865%1853.33e-46Ribosomal protein L19 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2438 PE=3 SV=1
A0A1E3PJF7_9ASCO67.553%1881.17e-45Ribosomal protein L19 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46248 PE=3 SV=1
A0A161HJC7_9ASCO67.000%1001.32e-14Ribosomal 60S subunit protein L19A OS=Sugiyamaella lignohabitans GN=RPL19A PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2236

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 225

Detailed signature matches

    1. SM01416 (Ribosomal_...)
    2. SSF48140 (Ribosomal...)
    3. MF_01475 (Ribosomal...)
    4. PF01280 (Ribosomal_...)
    1. cd01417 (Ribosomal_...)
    1. PS00526 (RIBOSOMAL_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Residue annotation

  1. protein-rRNA inter...
  2. putative transloco...
  3. putative intersubu...

Protein sequence

>MIA_06335_1
MTLNDCAWVWVIPSEIFPTYAYTHISIYIRLGLQHLKLANLKLQKRLASSVLGVGKRKIWLDPAETTAISEANSRQTVRK
LVDNGIIIRKPETGHSRARARAHKEAKRAGRHSGYGKRKGTANARMPSKVLWMRRIRVLRRLISKYRDANKIDKTLYRTL
YQESKGNTFKHKRALVEHIIKAKAEAAREKSIREEAEARREKLRAVKARRQQRIVEKREALLKDE

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit