Protein

MCA_01968_2

Length
188 amino acids


Gene name: RPL19A

Description: 60S ribosomal protein L19-A

Browser: contigA:5994644-5995592+

RNA-seq: read pairs 74647, FPKM 4880.1, percentile rank 99.6% (100% = highest expression)

Protein function

Annotation:RPL19A60S ribosomal protein L19-A
KEGG:K02885RP-L19e large subunit ribosomal protein L19e
EGGNOG:0PHM4ribosomal protein L19
SGD closest match:S000002156RPL19A60S ribosomal protein L19-A
CGD closest match:CAL0000180894RPL19ARibosomal protein L19

Protein alignments

%idAln lengthE-value
MIA_06335_179.41%1367e-56MIA_06335_1
A0A0J9X8S8_GEOCN77.21%1367e-56Ribosomal protein L19 OS=Geotrichum candidum GN=BN980_GECA05s03937g PE=3 SV=1
Q6C4N4_YARLI72.79%1366e-52YALI0E25025p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E25025g PE=3 SV=1
A0A060TA60_BLAAD75.00%1362e-51ARAD1D16632p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D16632g PE=3 SV=1
A0A1E3PJF7_9ASCO73.53%1363e-50Ribosomal protein L19 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46248 PE=3 SV=1
RL19A_YEAST69.12%1362e-5060S ribosomal protein L19-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL19A PE=1 SV=1
UniRef50_P0CX8269.12%1365e-4760S ribosomal protein L19-A n=374 Tax=Eukaryota TaxID=2759 RepID=RL19A_YEAST
A0A1D8PK40_CANAL72.06%1363e-49Ribosomal protein L19 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL19A PE=3 SV=1
A0A1E4TG62_9ASCO68.42%1334e-43Ribosomal protein L19 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2438 PE=3 SV=1
A0A161HJC7_9ASCO85.42%485e-12Ribosomal 60S subunit protein L19A OS=Sugiyamaella lignohabitans GN=RPL19A PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8782
Predicted cleavage: 11

Protein family membership

None predicted.

Domains and repeats

1 20 40 60 80 100 120 140 160 188

Detailed signature matches

    1. SM01416 (Ribosomal_...)
    2. MF_01475 (Ribosomal...)
    3. SSF48140 (Ribosomal...)
    4. PF01280 (Ribosomal_...)
    1. cd01417 (Ribosomal_...)
    1. PS00526 (RIBOSOMAL_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Residue annotation

  1. protein-rRNA inter...
  2. putative transloco...
  3. putative intersubu...

Protein sequence

>MCA_01968_2
MANLKFQKRIAASVLGVGTRKIWLDPTEISNISAANSRQSVRKLINDGLVIKKPVTGHSRARARAHKEAKRNGRHSGYGK
RKGTANARMPTSVLWMRRLRVLRRLLAKYRDSGKIDKTLYHTLYQEAKGNTFKHKRALIEHIIKAKAEAAREKSLQEEAE
ARRERLRAVKVKRQQRQQAKKEALLRDD

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit