Protein
MIA_06302_1
Length
169 amino acids
Browser: contig11:41228-41738+
Protein function
EGGNOG: | 0PKT5 | RPL17 | 60s ribosomal protein l17 |
---|---|---|---|
SGD closest match: | S000001663 | RPL17A | 60S ribosomal protein L17-A |
CGD closest match: | CAL0000193181 | RPL17B | Ribosomal 60S subunit protein L17B |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_06292_1 | 86.982% | 169 | 8.63e-100 | MCA_06292_1 |
RL17A_YEAST | 74.667% | 150 | 7.85e-84 | 60S ribosomal protein L17-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL17A PE=1 SV=4 |
UniRef50_P05740 | 74.667% | 150 | 1.88e-80 | 60S ribosomal protein L17-A n=88 Tax=Eukaryota TaxID=2759 RepID=RL17A_YEAST |
A0A0J9XC80_GEOCN | 77.703% | 148 | 1.94e-83 | Similar to Saccharomyces cerevisiae YKL180W RPL17A Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA07s04784g PE=3 SV=1 |
A0A167ESM4_9ASCO | 76.667% | 150 | 2.58e-83 | Ribosomal 60S subunit protein L17A OS=Sugiyamaella lignohabitans GN=RPL17A PE=3 SV=1 |
A0A1E3PT22_9ASCO | 76.667% | 150 | 3.64e-81 | Putative cytosolic ribosomal protein L17 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_19531 PE=3 SV=1 |
Q59TE0_CANAL | 69.277% | 166 | 1.84e-80 | Ribosomal 60S subunit protein L17B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL17B PE=3 SV=1 |
RL17_YARLI | 72.667% | 150 | 4.49e-80 | 60S ribosomal protein L17 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPL17 PE=3 SV=1 |
A0A060THM7_BLAAD | 70.000% | 150 | 2.80e-76 | ARAD1D32428p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D32428g PE=3 SV=1 |
A0A1E4TGM8_9ASCO | 68.667% | 150 | 2.30e-75 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31673 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.7769
Predicted cleavage: 32
Protein family membership
- Ribosomal protein L22/L17 (IPR001063)
- Ribosomal protein L22/L17, eukaryotic/archaeal (IPR005721)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PS00464 (RIBOSOMAL_L22)
-

Unintegrated signatures
Residue annotation
-
putative transloco...
-
protein-rRNA inter...
Protein sequence
>MIA_06302_1 MTRYAATSIDASNSASSRGSYLRVSFKNTRETAQAVSGWQANKALQYLEAVSDKKRAIPFRRFNGSIGRTAQGKEFGVTK ARWPVKSCKFVSDLIKNALANAEVKGLDASTLYIKHIQVNQAPKVRRRTYRAHGRINAYKSSPSHIEIILAPEAESVPAA EEDKQVATA
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome
GO:0015934 large ribosomal subunit