Protein

MIA_06302_1

Length
169 amino acids


Browser: contig11:41228-41738+

Protein function

EGGNOG:0PKT5RPL1760s ribosomal protein l17
SGD closest match:S000001663RPL17A60S ribosomal protein L17-A
CGD closest match:CAL0000193181RPL17BRibosomal 60S subunit protein L17B

Protein alignments

%idAln lengthE-value
MCA_06292_186.982%1698.63e-100MCA_06292_1
RL17A_YEAST74.667%1507.85e-8460S ribosomal protein L17-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL17A PE=1 SV=4
UniRef50_P0574074.667%1501.88e-8060S ribosomal protein L17-A n=88 Tax=Eukaryota TaxID=2759 RepID=RL17A_YEAST
A0A0J9XC80_GEOCN77.703%1481.94e-83Similar to Saccharomyces cerevisiae YKL180W RPL17A Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA07s04784g PE=3 SV=1
A0A167ESM4_9ASCO76.667%1502.58e-83Ribosomal 60S subunit protein L17A OS=Sugiyamaella lignohabitans GN=RPL17A PE=3 SV=1
A0A1E3PT22_9ASCO76.667%1503.64e-81Putative cytosolic ribosomal protein L17 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_19531 PE=3 SV=1
Q59TE0_CANAL69.277%1661.84e-80Ribosomal 60S subunit protein L17B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL17B PE=3 SV=1
RL17_YARLI72.667%1504.49e-8060S ribosomal protein L17 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPL17 PE=3 SV=1
A0A060THM7_BLAAD70.000%1502.80e-76ARAD1D32428p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D32428g PE=3 SV=1
A0A1E4TGM8_9ASCO68.667%1502.30e-75Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31673 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.7769
Predicted cleavage: 32

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF00237 (Ribosomal_L22)
    2. SSF54843 (Ribosomal...)
    3. cd00336 (Ribosomal_L22)
    1. PS00464 (RIBOSOMAL_L22)
Unintegrated signatures no IPR
Unintegrated signatures

Residue annotation

  1. putative transloco...
  2. protein-rRNA inter...

Protein sequence

>MIA_06302_1
MTRYAATSIDASNSASSRGSYLRVSFKNTRETAQAVSGWQANKALQYLEAVSDKKRAIPFRRFNGSIGRTAQGKEFGVTK
ARWPVKSCKFVSDLIKNALANAEVKGLDASTLYIKHIQVNQAPKVRRRTYRAHGRINAYKSSPSHIEIILAPEAESVPAA
EEDKQVATA

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome
GO:0015934 large ribosomal subunit