Protein
MCA_06292_1
Length
169 amino acids
Gene name: RPL17
Description: 60S ribosomal protein L17
Browser: contigD:3781340-3781850-
RNA-seq: read pairs 47566, FPKM 3457.2, percentile rank 98.8% (100% = highest expression)
Protein function
| Annotation: | RPL17 | 60S ribosomal protein L17 | |
|---|---|---|---|
| KEGG: | K02880 | RP-L17e | large subunit ribosomal protein L17e |
| EGGNOG: | 0PKT5 | RPL17 | 60s ribosomal protein l17 |
| SGD closest match: | S000003713 | RPL17B | 60S ribosomal protein L17-B |
| CGD closest match: | CAL0000193181 | RPL17B | Ribosomal 60S subunit protein L17B |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_06302_1 | 86.98% | 169 | 4e-108 | MIA_06302_1 |
| UniRef50_Q6BM53 | 68.67% | 166 | 8e-82 | 60S ribosomal protein L17 n=57 Tax=Eukaryota TaxID=2759 RepID=RL17_DEBHA |
| A0A167ESM4_9ASCO | 74.07% | 162 | 1e-84 | Ribosomal 60S subunit protein L17A OS=Sugiyamaella lignohabitans GN=RPL17A PE=3 SV=1 |
| RL17B_YEAST | 69.28% | 166 | 8e-84 | 60S ribosomal protein L17-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL17B PE=1 SV=2 |
| Q59TE0_CANAL | 69.28% | 166 | 9e-83 | Ribosomal 60S subunit protein L17B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL17B PE=3 SV=1 |
| A0A0J9XC80_GEOCN | 71.69% | 166 | 2e-81 | Similar to Saccharomyces cerevisiae YKL180W RPL17A Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA07s04784g PE=3 SV=1 |
| A0A1E3PT22_9ASCO | 68.67% | 166 | 1e-79 | Putative cytosolic ribosomal protein L17 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_19531 PE=3 SV=1 |
| A0A060THM7_BLAAD | 66.87% | 166 | 1e-78 | ARAD1D32428p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D32428g PE=3 SV=1 |
| RL17_YARLI | 66.67% | 162 | 9e-78 | 60S ribosomal protein L17 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPL17 PE=3 SV=1 |
| A0A1E4TGM8_9ASCO | 65.43% | 162 | 1e-76 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31673 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.6560
Predicted cleavage: 32
Protein family membership
- Ribosomal protein L22/L17 (IPR001063)
- Ribosomal protein L22/L17, eukaryotic/archaeal (IPR005721)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PS00464 (RIBOSOMAL_L22)
-
no IPR
Unintegrated signatures
Residue annotation
-
putative transloco...
-
protein-rRNA inter...
Protein sequence
>MCA_06292_1 MTRYAATSTDSANSAQSRGSYLRVSFKNTRETAQAVNGWQVNKALSYLDAVSEKKRAIPMRRFNGSIGRTGQGKEFGVTK ARWPVKSVKFVSDLIKNALANAEAKGLDASELYIKHIQVNRAPKLRRRTYRAHGRINAYKASPCHIEIILAPETESIPAA EEDKQVTAA
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome
GO:0015934 large ribosomal subunit