Protein
MIA_06299_1
Length
124 amino acids
Browser: contig11:37949-38372+
Protein function
| CGD closest match: | CAL0000200924 | orf19.3687 | Prefolding complex chaperone subunit |
|---|
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XB75_GEOCN | 51.639% | 122 | 5.76e-40 | Similar to Saccharomyces cerevisiae YJL179W PFD1 Subunit of heterohexameric prefoldin OS=Geotrichum candidum GN=BN980_GECA07s04740g PE=4 SV=1 |
| UniRef50_A0A0J9XB75 | 51.639% | 122 | 1.18e-36 | Similar to Saccharomyces cerevisiae YJL179W PFD1 Subunit of heterohexameric prefoldin n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XB75_GEOCN |
| MCA_06295_1 | 48.387% | 124 | 9.28e-37 | MCA_06295_1 |
| A0A161HHD0_9ASCO | 38.532% | 109 | 1.09e-17 | Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_3027 PE=4 SV=1 |
| A0A1E3PSK8_9ASCO | 33.607% | 122 | 5.65e-17 | Prefoldin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49054 PE=4 SV=1 |
| A0A060TC30_BLAAD | 33.036% | 112 | 1.87e-15 | ARAD1D32802p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D32802g PE=4 SV=1 |
| Q59VX1_CANAL | 25.893% | 112 | 1.88e-07 | Prefolding complex chaperone subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3687 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2690
Protein family membership
- Prefoldin beta-like (IPR002777)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01920 (Prefoldin_2)
-
no IPR
Unintegrated signatures
-
-
-
SSF46579 (Prefoldin)
Protein sequence
>MIA_06299_1 MSISNDALQKTLGEMQSRAITVSKELQALSIQEASLIRRTKLSDATENQLKELTHYSAGSTDKPIWKGVGKMFLSTPLEQ QLDSMKNERLEYQEQLKALEKKRLYLDNTYKNVINALNELNVSK
GO term prediction
Biological Process
GO:0006457 protein folding
Molecular Function
GO:0051082 unfolded protein binding
Cellular Component
GO:0016272 prefoldin complex