Protein

MCA_06295_1

Length
121 amino acids


Browser: contigD:3785760-3786217-

RNA-seq: read pairs 931, FPKM 94.3, percentile rank 77.6% (100% = highest expression)

Protein function

KEGG:K09548PFDN1 prefoldin subunit 1
SGD closest match:S000003715PFD1Prefoldin subunit 1
CGD closest match:CAL0000200924orf19.3687Prefolding complex chaperone subunit

Protein alignments

%idAln lengthE-value
A0A0J9XB75_GEOCN51.26%1196e-40Similar to Saccharomyces cerevisiae YJL179W PFD1 Subunit of heterohexameric prefoldin OS=Geotrichum candidum GN=BN980_GECA07s04740g PE=4 SV=1
UniRef50_A0A0J9XB7551.26%1191e-36Similar to Saccharomyces cerevisiae YJL179W PFD1 Subunit of heterohexameric prefoldin n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XB75_GEOCN
MIA_06299_148.39%1241e-35MIA_06299_1
A0A161HHD0_9ASCO42.72%1033e-23Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_3027 PE=4 SV=1
A0A1E3PSK8_9ASCO36.70%1092e-16Prefoldin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49054 PE=4 SV=1
A0A060TC30_BLAAD39.42%1048e-16ARAD1D32802p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D32802g PE=4 SV=1
Q59VX1_CANAL30.51%1183e-14Prefolding complex chaperone subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3687 PE=4 SV=1
Q6CBT0_YARLI31.31%994e-09YALI0C15829p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C15829g PE=4 SV=1
PFD1_YEAST30.11%933e-07Prefoldin subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFD1 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2337

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF01920 (Prefoldin_2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF46579 (Prefoldin)

Protein sequence

>MCA_06295_1
MSLPPEVLQKTLSDMQFKILSTSTEMQAVQQQEATILRKIRLSETTEKQINELTQNKPDTTVWKGVGKMFLSTTVADQIQ
DLEKERKEYQEQLSALKKKQNYLENTYKNLTSAFQNISVGK

GO term prediction

Biological Process

GO:0006457 protein folding

Molecular Function

GO:0051082 unfolded protein binding

Cellular Component

GO:0016272 prefoldin complex