Protein
MIA_06262_1
Length
127 amino acids
Browser: contig10:740427-740857+
Protein function
| EGGNOG: | 0PRDI | QCR7 | component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain |
|---|---|---|---|
| SGD closest match: | S000002937 | QCR7 | Cytochrome b-c1 complex subunit 7 |
| CGD closest match: | CAL0000200050 | QCR7 | Cytochrome b-c1 complex subunit 7 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_03160_1 | 90.551% | 127 | 1.05e-81 | MCA_03160_1 |
| A0A0J9XK11_GEOCN | 75.397% | 126 | 2.20e-66 | Cytochrome b-c1 complex subunit 7 OS=Geotrichum candidum GN=BN980_GECA23s01077g PE=3 SV=1 |
| UniRef50_A0A0J9XK11 | 75.397% | 126 | 4.50e-63 | Cytochrome b-c1 complex subunit 7 n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XK11_GEOCN |
| QCR7_YEAST | 58.871% | 124 | 3.08e-52 | Cytochrome b-c1 complex subunit 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR7 PE=1 SV=2 |
| QCR7_YARLI | 59.055% | 127 | 1.18e-51 | Cytochrome b-c1 complex subunit 7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=QCR7 PE=3 SV=1 |
| Q5ABS1_CANAL | 59.836% | 122 | 8.63e-50 | Cytochrome b-c1 complex subunit 7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QCR7 PE=3 SV=1 |
| A0A1E3PER2_9ASCO | 54.331% | 127 | 3.36e-45 | Cytochrome b-c1 complex subunit 7 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47696 PE=3 SV=1 |
| A0A060T4R3_BLAAD | 61.417% | 127 | 1.60e-43 | Cytochrome b-c1 complex subunit 7 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B05302g PE=3 SV=1 |
| A0A1E4TK66_9ASCO | 46.721% | 122 | 3.12e-34 | Cytochrome b-c1 complex subunit 7 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_743 PE=3 SV=1 |
| A0A167E2N2_9ASCO | 50.495% | 101 | 4.59e-34 | Cytochrome b-c1 complex subunit 7 OS=Sugiyamaella lignohabitans GN=QCR7 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.8689
Predicted cleavage: 40
Protein family membership
- Cytochrome b-c1 complex subunit 7 (IPR003197)
Domains and repeats
None predicted.
Detailed signature matches
-
-
SSF81524 (14 kDa pr...)
-
PF02271 (UCR_14kD)
-
PIRSF000022 (Bc1_14K)
-
-
-
Protein sequence
>MIA_06262_1 MASVTSVVKASEYILKSPFLSSIFVPISKTFVNLSGYRRMGLKFDDLIAEESPIVQTALKRLDEKESYDRVFRILTASQL SLTAQILPKNEAVKPEDDTSYLIPYILEAEAAAFERSALDNITVVKK
GO term prediction
Biological Process
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
Molecular Function
None predicted.
Cellular Component
GO:0005750 mitochondrial respiratory chain complex III