Protein

MCA_03160_1

Length
127 amino acids

Gene name: QCR7

Description: Cytochrome b-c1 complex subunit 7

Browser: contigB:3514752-3515242+

RNA-seq: read pairs 29044, FPKM 2803.7, percentile rank 98.3% (100% = highest expression)

Protein function

Annotation:QCR7Cytochrome b-c1 complex subunit 7
KEGG:K00417QCR7 ubiquinol-cytochrome c reductase subunit 7
EGGNOG:0PRDIQCR7component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain
SGD closest match:S000002937QCR7Cytochrome b-c1 complex subunit 7
CGD closest match:CAL0000200050QCR7Cytochrome b-c1 complex subunit 7

Protein alignments

%idAln lengthE-value
MIA_06262_190.55%1274e-80MIA_06262_1
A0A0J9XK11_GEOCN75.40%1269e-66Cytochrome b-c1 complex subunit 7 OS=Geotrichum candidum GN=BN980_GECA23s01077g PE=3 SV=1
UniRef50_A0A0J9XK1175.40%1262e-62Cytochrome b-c1 complex subunit 7 n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XK11_GEOCN
QCR7_YARLI58.27%1278e-48Cytochrome b-c1 complex subunit 7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=QCR7 PE=3 SV=1
Q5ABS1_CANAL56.56%1223e-46Cytochrome b-c1 complex subunit 7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QCR7 PE=3 SV=1
QCR7_YEAST55.65%1243e-46Cytochrome b-c1 complex subunit 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR7 PE=1 SV=2
A0A1E3PER2_9ASCO49.61%1272e-39Cytochrome b-c1 complex subunit 7 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47696 PE=3 SV=1
A0A060T4R3_BLAAD58.27%1273e-39Cytochrome b-c1 complex subunit 7 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B05302g PE=3 SV=1
A0A167E2N2_9ASCO50.50%1012e-33Cytochrome b-c1 complex subunit 7 OS=Sugiyamaella lignohabitans GN=QCR7 PE=3 SV=1
A0A1E4TK66_9ASCO45.08%1224e-30Cytochrome b-c1 complex subunit 7 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_743 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9083
Predicted cleavage: 40

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR003197
    Cytochrome b-c1 complex subunit 7
    1. SSF81524 (14 kDa pr...)
    2. PF02271 (UCR_14kD)
    3. PIRSF000022 (Bc1_14K)
    4. PD008153
    5. G3DSA:1.10.10...

Protein sequence

>MCA_03160_1
MASVTSVVKASEYILKSPFLSSIFVPLSKTFVNLSGYRRMGLRFDDLIAEESDIVQTALKRLDEKESYDRVYRMLTACQL
SLTCQILPKDKSLKPEDDKSYLIPYILEAEAAAFERSALDNITVVKK

GO term prediction

Biological Process

GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c

Molecular Function

None predicted.

Cellular Component

GO:0005750 mitochondrial respiratory chain complex III