Protein

MIA_06253_1

Length
412 amino acids

Browser: contig10:725194-726433+

Protein function

EGGNOG:0PHTR3-ketoacyl-coa thiolase
SGD closest match:S000001422POT13-ketoacyl-CoA thiolase, peroxisomal
CGD closest match:CAL0000175559POT1-2Pot1-2p

Protein alignments

%idAln lengthE-value
MCA_00697_184.951%4120.0MCA_00697_1
UniRef50_G1X5K563.830%4230.0Uncharacterized protein n=3 Tax=Orbiliaceae TaxID=47021 RepID=G1X5K5_ARTOA
A0A167DFK5_9ASCO63.659%4100.0Acetyl-CoA C-acyltransferase OS=Sugiyamaella lignohabitans GN=POT1 PE=3 SV=1
A0A060TEZ7_BLAAD59.854%4118.45e-172ARAD1D18480p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D18480g PE=3 SV=1
Q5AD21_CANAL58.911%4042.05e-170Pot1-2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=POT1-2 PE=3 SV=1
A0A1E3PSS7_9ASCO48.267%4042.99e-116Peroxisomal 3-oxoacyl-CoA thiolase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48961 PE=3 SV=1
A0A0J9XDV0_GEOCN47.912%4073.74e-116Similar to Saccharomyces cerevisiae YIL160C POT1 3-ketoacyl-CoA thiolase with broad chain length specificity, cleaves 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA during beta-oxidation of fatty acids OS=Geotrichum candidum GN=BN980_GECA11s01451g PE=3 SV=1
THIK_YARLI49.389%4094.89e-1153-ketoacyl-CoA thiolase, peroxisomal OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=POT1 PE=3 SV=1
A0A1E4THP9_9ASCO47.044%4066.66e-115Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31916 PE=3 SV=1
THIK_YEAST42.579%4115.38e-983-ketoacyl-CoA thiolase, peroxisomal OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POT1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.5425

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 412

Detailed signature matches

  1. Family IPR002155
    Thiolase
    1. TIGR01930
    2. cd00751 (thiolase)
    3. PIRSF000429 (Ac-CoA...)
  2. Domain IPR016039
    Thiolase-like
    1. SSF53901 (Thiolase-...)
    2. G3DSA:3.40.47.10
  3. Domain IPR020616
    Thiolase, N-terminal
    1. PF00108 (Thiolase_N)
  4. Domain IPR020617
    Thiolase, C-terminal
    1. PF02803 (Thiolase_C)
  5. SITE IPR020613
    Thiolase, conserved site
    1. PS00737 (THIOLASE_2)

Residue annotation

  1. dimer interface cd...
  2. active site cd00751

Protein sequence

>MIA_06253_1
MLRKGLTNVLEKLPTDVVIVSALRTPVTKAVKGGLAKMAPEELLATVLKGTLEKTKINPAEVQDVLVGAVLQKLSGQKAC
AAAIKHVGFPHTTTVNTINRQCSSSAQAASYIANNICANNGEHFNIGLAAGVESMSFDYFPHRGIPERVADSIKNSPIEE
ARDVLMPMGITSENVAKEYGISRADQDAFGLLSQQKAAKAWESGHFDAEIVPVEARVFDKETGEIKENEWTTITKDDGFR
KGLTLEKLAKLKPAFTDDGTTTAGNASQISDGASATLLMTRAKANELGIKPIGKIVHSAVAGVPSRLMGIAPAVAIPTLL
KQLGLENKDIDIWELNEAFASQSLYVIRSLGIDIDKVNPFGGAIALGHPLGATGGRLIATLMNGLNSLDKELGVVSMCAS
TGQGYAGLFVRE

GO term prediction

Biological Process

GO:0008152 metabolic process

Molecular Function

GO:0003824 catalytic activity
GO:0016747 transferase activity, transferring acyl groups other than amino-acyl groups

Cellular Component

None predicted.