Protein

MIA_06216_1

Length
113 amino acids

Browser: contig10:608464-608874+

Protein function

EGGNOG:0PNWCCKS1kinase regulatory subunit
SGD closest match:S000000339CKS1Cyclin-dependent kinases regulatory subunit
CGD closest match:CAL0000189770CKS1Cyclin-dependent kinases regulatory subunit

Protein alignments

%idAln lengthE-value
MCA_05058_187.629%971.09e-62MCA_05058_1
Q6C172_YARLI84.375%966.22e-59Cyclin-dependent kinases regulatory subunit OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F18700g PE=3 SV=1
UniRef50_Q6C17284.375%961.44e-55Cyclin-dependent kinases regulatory subunit n=30 Tax=Dikarya TaxID=451864 RepID=Q6C172_YARLI
A0A0J9XDX4_GEOCN83.158%953.19e-57Cyclin-dependent kinases regulatory subunit OS=Geotrichum candidum GN=BN980_GECA11s01704g PE=3 SV=1
Q59LQ4_CANAL80.000%951.17e-54Cyclin-dependent kinases regulatory subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CKS1 PE=3 SV=1
CKS1_YEAST80.645%932.71e-53Cyclin-dependent kinases regulatory subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CKS1 PE=1 SV=1
A0A060TCJ3_BLAAD68.696%1151.90e-52Cyclin-dependent kinases regulatory subunit OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D42922g PE=3 SV=1
A0A1E4TKU3_9ASCO74.227%972.38e-52Cyclin-dependent kinases regulatory subunit OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30555 PE=3 SV=1
A0A1E3PIZ4_9ASCO73.404%944.88e-49Cyclin-dependent kinases regulatory subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46913 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1113
Predicted cleavage: 29

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR000789
    Cyclin-dependent kinase, regulatory subunit
    1. SSF55637 (Cell cycl...)
    2. PS00945 (CKS_2)
    3. PF01111 (CKS)
    4. G3DSA:3.30.17...
    5. SM01084 (CKS_2)
    6. PS00944 (CKS_1)
    7. PR00296 (CYCLINKINASE)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_06216_1
MDKYQQSSHSSQQQHQRPRMLTPEEKARITEFQEMIHYSTRYSDDNFEYRHVMLPKTMLKAIPRDYFNPETGTLRILLEQ
EWRGLGITQSLGWEHYENHAPEPHILLFKRPKA

GO term prediction

Biological Process

GO:0007049 cell cycle

Molecular Function

GO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity

Cellular Component

None predicted.