Protein
MCA_05058_1
Length
108 amino acids
Gene name: CKS1
Description: Cyclin-dependent kinases regulatory subunit
Browser: contigD:253255-253750-
RNA-seq: read pairs 1644, FPKM 186.4, percentile rank 87.3% (100% = highest expression)
Protein function
| Annotation: | CKS1 | Cyclin-dependent kinases regulatory subunit | |
|---|---|---|---|
| KEGG: | K02219 | CKS1 | cyclin-dependent kinase regulatory subunit CKS1 |
| EGGNOG: | 0PNWC | CKS1 | kinase regulatory subunit |
| SGD closest match: | S000000339 | CKS1 | Cyclin-dependent kinases regulatory subunit |
| CGD closest match: | CAL0000189770 | CKS1 | Cyclin-dependent kinases regulatory subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_06216_1 | 87.63% | 97 | 3e-61 | MIA_06216_1 |
| Q6C172_YARLI | 84.69% | 98 | 9e-59 | Cyclin-dependent kinases regulatory subunit OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F18700g PE=3 SV=1 |
| UniRef50_Q6C172 | 84.69% | 98 | 2e-55 | Cyclin-dependent kinases regulatory subunit n=30 Tax=Dikarya TaxID=451864 RepID=Q6C172_YARLI |
| A0A0J9XDX4_GEOCN | 85.26% | 95 | 4e-57 | Cyclin-dependent kinases regulatory subunit OS=Geotrichum candidum GN=BN980_GECA11s01704g PE=3 SV=1 |
| A0A1E4TKU3_9ASCO | 78.57% | 98 | 3e-55 | Cyclin-dependent kinases regulatory subunit OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30555 PE=3 SV=1 |
| Q59LQ4_CANAL | 81.05% | 95 | 1e-54 | Cyclin-dependent kinases regulatory subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CKS1 PE=3 SV=1 |
| A0A060TCJ3_BLAAD | 70.43% | 115 | 1e-52 | Cyclin-dependent kinases regulatory subunit OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D42922g PE=3 SV=1 |
| CKS1_YEAST | 78.95% | 95 | 3e-51 | Cyclin-dependent kinases regulatory subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CKS1 PE=1 SV=1 |
| A0A1E3PIZ4_9ASCO | 76.60% | 94 | 2e-49 | Cyclin-dependent kinases regulatory subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46913 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2074
Predicted cleavage: 24
Protein family membership
- Cyclin-dependent kinase, regulatory subunit (IPR000789)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_05058_1 MKKSENLHYSQQPRLLTQSEKARLFEFQEMIHYSSRYSDDHYEYRHVILPKNMLKAIPKDYFNPETGTLRILLEQEWRGL GITQSLGWEHYENHAPEPHILLFKRPKA
GO term prediction
Biological Process
GO:0007049 cell cycle
Molecular Function
GO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity
Cellular Component
None predicted.