Protein
MIA_06211_1
Length
81 amino acids
Browser: contig10:595316-595645-
Protein function
| EGGNOG: | 0PRTW | FG04915.1 | 40S ribosomal protein S30 |
|---|---|---|---|
| SGD closest match: | S000004278 | RPS30A | 40S ribosomal protein S30-A |
| CGD closest match: | CAL0000193815 | RPS30 | 40S ribosomal protein S30 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_00916_2 | 87.10% | 62 | 3e-32 | MCA_00916_2 |
| A0A060TA00_BLAAD | 85.25% | 61 | 4e-32 | 40S ribosomal protein S30 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B03828g PE=3 SV=1 |
| UniRef50_A0A1E4S207 | 83.61% | 61 | 1e-28 | 40S ribosomal protein S30 n=6 Tax=Eukaryota TaxID=2759 RepID=A0A1E4S207_CYBJA |
| A0A1E3PP33_9ASCO | 82.26% | 62 | 3e-31 | 40S ribosomal protein S30 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_64356 PE=3 SV=1 |
| A0A1D8PSK2_CANAL | 78.69% | 61 | 5e-29 | 40S ribosomal protein S30 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS30 PE=3 SV=1 |
| Q6C1N9_YARLI | 78.57% | 56 | 2e-25 | 40S ribosomal protein S30 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F14663g PE=3 SV=1 |
| RS30A_YEAST | 84.75% | 59 | 3e-24 | 40S ribosomal protein S30-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS30A PE=1 SV=1 |
| A0A0J9X5B3_GEOCN | 85.48% | 62 | 1e-22 | 40S ribosomal protein S30 OS=Geotrichum candidum GN=BN980_GECA03s00422g PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2459
Protein family membership
- Ribosomal protein S30 (IPR006846)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF04758 (Ribosomal_S30)
-
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_06211_1 MILSSTGLHTFFTCKINDPGKVHGSLARAGKVKSQTPKVEKQEKAKVPKGRAHKRILYNKRFVNVTLVNGKRRSNPGPGS A
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome