Protein

MCA_00916_2

Length
63 amino acids

Gene name: RPS30

Description: 40S ribosomal protein S30

Browser: contigA:2886679-2887156-

RNA-seq: read pairs 23815, FPKM 4597.8, percentile rank 99.5% (100% = highest expression)

Protein function

Annotation:RPS3040S ribosomal protein S30
KEGG:K02983RP-S30e small subunit ribosomal protein S30e
EGGNOG:0PRTWFG04915.140S ribosomal protein S30
SGD closest match:S000004278RPS30A40S ribosomal protein S30-A
CGD closest match:CAL0000193815RPS3040S ribosomal protein S30

Protein alignments

%idAln lengthE-value
UniRef50_A0A1E4S20785.48%622e-1640S ribosomal protein S30 n=6 Tax=Eukaryota TaxID=2759 RepID=A0A1E4S207_CYBJA
A0A0J9X5B3_GEOCN88.89%632e-1940S ribosomal protein S30 OS=Geotrichum candidum GN=BN980_GECA03s00422g PE=3 SV=1
A0A060TA00_BLAAD88.71%626e-1940S ribosomal protein S30 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B03828g PE=3 SV=1
A0A1E3PP33_9ASCO86.89%611e-1840S ribosomal protein S30 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_64356 PE=3 SV=1
MIA_06211_187.10%623e-18MIA_06211_1
A0A1D8PSK2_CANAL80.65%623e-1840S ribosomal protein S30 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS30 PE=3 SV=1
RS30A_YEAST83.61%614e-1740S ribosomal protein S30-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS30A PE=1 SV=1
Q6C1N9_YARLI78.95%573e-1340S ribosomal protein S30 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F14663g PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3017

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR006846
    Ribosomal protein S30
    1. PF04758 (Ribosomal_S30)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_00916_2
MGKVHGSLARAGKVKSATPKVEKQEKKKTPKGRAKKRMLYTKRFVNVTLTNGKRRSNPGPSSA

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome