Protein
MCA_00916_2
Length
63 amino acids
Gene name: RPS30
Description: 40S ribosomal protein S30
Browser: contigA:2886679-2887156-
RNA-seq: read pairs 23815, FPKM 4597.8, percentile rank 99.5% (100% = highest expression)
Protein function
Annotation: | RPS30 | 40S ribosomal protein S30 | |
---|---|---|---|
KEGG: | K02983 | RP-S30e | small subunit ribosomal protein S30e |
EGGNOG: | 0PRTW | FG04915.1 | 40S ribosomal protein S30 |
SGD closest match: | S000004278 | RPS30A | 40S ribosomal protein S30-A |
CGD closest match: | CAL0000193815 | RPS30 | 40S ribosomal protein S30 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
UniRef50_A0A1E4S207 | 85.48% | 62 | 2e-16 | 40S ribosomal protein S30 n=6 Tax=Eukaryota TaxID=2759 RepID=A0A1E4S207_CYBJA |
A0A0J9X5B3_GEOCN | 88.89% | 63 | 2e-19 | 40S ribosomal protein S30 OS=Geotrichum candidum GN=BN980_GECA03s00422g PE=3 SV=1 |
A0A060TA00_BLAAD | 88.71% | 62 | 6e-19 | 40S ribosomal protein S30 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B03828g PE=3 SV=1 |
A0A1E3PP33_9ASCO | 86.89% | 61 | 1e-18 | 40S ribosomal protein S30 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_64356 PE=3 SV=1 |
MIA_06211_1 | 87.10% | 62 | 3e-18 | MIA_06211_1 |
A0A1D8PSK2_CANAL | 80.65% | 62 | 3e-18 | 40S ribosomal protein S30 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS30 PE=3 SV=1 |
RS30A_YEAST | 83.61% | 61 | 4e-17 | 40S ribosomal protein S30-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS30A PE=1 SV=1 |
Q6C1N9_YARLI | 78.95% | 57 | 3e-13 | 40S ribosomal protein S30 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F14663g PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.3017
Protein family membership
- Ribosomal protein S30 (IPR006846)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF04758 (Ribosomal_S30)
-
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MCA_00916_2 MGKVHGSLARAGKVKSATPKVEKQEKKKTPKGRAKKRMLYTKRFVNVTLTNGKRRSNPGPSSA
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome