MIA_06205_1

Protein

Length

90 amino acids

Browser: contig10:561729-562002-

EGGNOG:	0PRY8	DPH3	Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L- methionine to a histidine residue. Diphthamide is a post- translational modification of histidine which occurs in elongation factor 2
SGD closest match:	S000007587	KTI11	Diphthamide biosynthesis protein 3
CGD closest match:	CAL0000195342	KTI11	Kti11p

	%id	Aln length	E-value
A0A0J9X4Z0_GEOCN	80.597%	67	3.87e-37	Similar to Saccharomyces cerevisiae YBL071W-A KTI11 Zn-ribbon protein that co-purifies with Dph1 and Dph2 in a complex required for synthesis of diphthamide on translation factor eEF2 OS=Geotrichum candidum GN=BN980_GECA02s07292g PE=4 SV=1
MCA_03466_1	74.286%	70	1.35e-33	MCA_03466_1
A0A060TE89_BLAAD	72.857%	70	9.47e-33	ARAD1D49918p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D49918g PE=4 SV=1
UniRef50_Q6CMG4	73.134%	67	1.25e-27	Diphthamide biosynthesis protein 3 n=75 Tax=Eukaryota TaxID=2759 RepID=DPH3_KLULA
DPH3_YEAST	62.857%	70	1.43e-29	Diphthamide biosynthesis protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTI11 PE=1 SV=1
A0A1E3PP01_9ASCO	67.143%	70	6.34e-29	Zf-CSL-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_57530 PE=4 SV=1
DPH3_YARLI	67.164%	67	2.20e-27	Diphthamide biosynthesis protein 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPH3 PE=3 SV=1
A0A1E4TA65_9ASCO	73.333%	60	3.93e-27	Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_29424 PE=4 SV=1
A0A1D8PHF7_CANAL	63.235%	68	1.60e-25	Kti11p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=KTI11 PE=4 SV=1

Probability of mitochondrial location: 0.0018

None predicted.

1 10 20 30 40 50 60 70 80 90 90

>MIA_06205_1
MSIYDEIEIEDMTFDEDTQLFTYPCPCGDRFQIFIDDLVDGSNNIAVCPSCSLQIEVIFEASDLEKYIKKEDSDAEEADG
ITSAPDLICA

None predicted.

None predicted.

None predicted.

Filter view on