Protein

MCA_03466_1

Length
80 amino acids


Gene name: DPH3

Description: Diphthamide biosynthesis protein 3

Browser: contigC:53803-54136+

RNA-seq: read pairs 955, FPKM 145.7, percentile rank 84.5% (100% = highest expression)

Protein function

Annotation:DPH3Diphthamide biosynthesis protein 3
KEGG:K15455DPH3 diphthamide biosynthesis protein 3
EGGNOG:0PRY8DPH3Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L- methionine to a histidine residue. Diphthamide is a post- translational modification of histidine which occurs in elongation factor 2
SGD closest match:S000007587KTI11Diphthamide biosynthesis protein 3
CGD closest match:CAL0000195342KTI11Kti11p

Protein alignments

%idAln lengthE-value
MIA_06205_174.29%702e-32MIA_06205_1
A0A0J9X4Z0_GEOCN70.15%672e-29Similar to Saccharomyces cerevisiae YBL071W-A KTI11 Zn-ribbon protein that co-purifies with Dph1 and Dph2 in a complex required for synthesis of diphthamide on translation factor eEF2 OS=Geotrichum candidum GN=BN980_GECA02s07292g PE=4 SV=1
UniRef50_C9SLN963.64%774e-25Diphthamide biosynthesis protein n=5 Tax=Fungi TaxID=4751 RepID=C9SLN9_VERA1
A0A060TE89_BLAAD65.15%662e-26ARAD1D49918p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D49918g PE=4 SV=1
A0A1E4TA65_9ASCO73.68%571e-23Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_29424 PE=4 SV=1
DPH3_YARLI62.69%672e-23Diphthamide biosynthesis protein 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPH3 PE=3 SV=1
A0A1E3PP01_9ASCO58.21%674e-22Zf-CSL-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_57530 PE=4 SV=1
DPH3_YEAST54.05%748e-22Diphthamide biosynthesis protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTI11 PE=1 SV=1
A0A1D8PHF7_CANAL60.00%655e-21Kti11p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=KTI11 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0011

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 70 80 80

Detailed signature matches

    1. PS51074 (ZF_DPH)
    2. SSF144217 (CSL zinc...)
    3. PF05207 (zf-CSL)

Protein sequence

>MCA_03466_1
MIYDEIEIEDMNYDEDMQIFTYPCPCGDQFQVAIDDLLDESTDIAVCPSCSLEIRVIFEMSDLSKFKKPEDEQQPPMICT

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.