Protein
MIA_06175_1
Length
264 amino acids
Browser: contig10:450370-451312+
Protein function
| EGGNOG: | 0PFE2 | SRT1 | Putative undecaprenyl diphosphate synthase |
|---|---|---|---|
| SGD closest match: | S000000206 | RER2 | Dehydrodolichyl diphosphate synthase complex subunit RER2 |
| CGD closest match: | CAL0000188102 | RER2 | Ditrans,polycis-polyprenyl diphosphate synthase ((2E,6E)-farnesyl diphosphate specific) |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_00395_1 | 69.466% | 262 | 8.91e-140 | MCA_00395_1 |
| A0A1E3PP48_9ASCO | 55.426% | 258 | 8.08e-109 | Ditrans,polycis-polyprenyl diphosphate synthase ((2E,6E)-farnesyl diphosphate specific) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50540 PE=3 SV=1 |
| A0A0J9X2I0_GEOCN | 54.054% | 259 | 5.75e-108 | Ditrans,polycis-polyprenyl diphosphate synthase ((2E,6E)-farnesyl diphosphate specific) OS=Geotrichum candidum GN=BN980_GECA01s01913g PE=3 SV=1 |
| UniRef50_A0A0J9X2I0 | 54.054% | 259 | 1.18e-104 | Ditrans,polycis-polyprenyl diphosphate synthase ((2E,6E)-farnesyl diphosphate specific) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X2I0_GEOCN |
| Q6C8R7_YARLI | 50.562% | 267 | 2.63e-99 | Ditrans,polycis-polyprenyl diphosphate synthase ((2E,6E)-farnesyl diphosphate specific) OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D17556g PE=3 SV=1 |
| A0A060T685_BLAAD | 47.860% | 257 | 6.04e-94 | Ditrans,polycis-polyprenyl diphosphate synthase ((2E,6E)-farnesyl diphosphate specific) OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B09548g PE=3 SV=1 |
| A0A161HIA6_9ASCO | 48.450% | 258 | 5.46e-91 | Ditrans,polycis-polyprenyl diphosphate synthase ((2E,6E)-farnesyl diphosphate specific) OS=Sugiyamaella lignohabitans GN=RER2 PE=3 SV=1 |
| Q5AJZ3_CANAL | 43.969% | 257 | 3.41e-86 | Ditrans,polycis-polyprenyl diphosphate synthase ((2E,6E)-farnesyl diphosphate specific) OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RER2 PE=3 SV=1 |
| A0A1E4TEJ9_9ASCO | 38.911% | 257 | 3.16e-72 | Ditrans,polycis-polyprenyl diphosphate synthase ((2E,6E)-farnesyl diphosphate specific) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_56760 PE=3 SV=1 |
| RER2_YEAST | 39.300% | 257 | 1.13e-62 | Dehydrodolichyl diphosphate synthase complex subunit RER2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RER2 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9355
Protein family membership
- Decaprenyl diphosphate synthase-like (IPR001441)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PS01066 (UPP_SYNTHASE)
-
no IPR
Unintegrated signatures
-
NON_CYTOPLASM... (N...)
-
SIGNAL_PEPTIDE (Sig...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
Residue annotation
-
active site cd00475
-
dimer interface cd...
Protein sequence
>MIA_06175_1 MSLRRWVSAFPAYGFLQGFARELLGNVVACGPVPQHIAFIMDGNRRFAKNNGLELGEGHVAGFESLSNILEILYNLGVYA VTVYAFSIENFNRPEHEIESLFNIIRSKLLLVSEKEAIPHRYGVSVRFIGNRELIPEDIMVLIENLENATKDMTRGILNI AFPYTSRDDMTQAIRTLVSDAESGDLDVAAIDEPLYEKAMYTGRSPPLDIMVRTSGETRLSDYMIWQSCDNCTVEFIDTL WPDINSWDAFKIIFKWSYKMYKQR
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
Cellular Component
None predicted.