Protein

MIA_06158_1

Length
191 amino acids

Browser: contig10:417498-418265+

Protein function

EGGNOG:0PQDKTIM22Mitochondrial import inner membrane translocase subunit tim22
SGD closest match:S000002376TIM22Mitochondrial import inner membrane translocase subunit TIM22
CGD closest match:CAL0000200177TIM22Translocation channel protein

Protein alignments

%idAln lengthE-value
MCA_03849_185.938%1923.52e-106MCA_03849_1
A0A0J9YHH6_GEOCN81.771%1921.15e-93Similar to Saccharomyces cerevisiae YDL217C TIM22 Essential core component of the mitochondrial TIM22 complex involved in insertion of polytopic proteins into the inner membrane OS=Geotrichum candidum GN=BN980_GECA01s04608g PE=4 SV=1
A0A1E3PSG2_9ASCO77.348%1811.10e-83Mitochondrial import inner membrane translocase subunit TIM22 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81288 PE=4 SV=1
A0A1D8PI78_CANAL66.667%1804.89e-80Translocation channel protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM22 PE=4 SV=1
A0A060SZY7_BLAAD76.503%1832.80e-79ARAD1C08316p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C08316g PE=4 SV=1
UniRef50_Q75E8063.784%1851.30e-74Mitochondrial import inner membrane translocase subunit TIM22 n=85 Tax=Fungi TaxID=4751 RepID=TIM22_ASHGO
TIM22_YARLI73.143%1757.57e-75Mitochondrial import inner membrane translocase subunit TIM22 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM22 PE=3 SV=2
A0A1E4T9Y6_9ASCO69.880%1663.59e-70Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3240 PE=4 SV=1
TIM22_YEAST60.513%1952.34e-66Mitochondrial import inner membrane translocase subunit TIM22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM22 PE=1 SV=1
A0A161HFI3_9ASCO26.804%972.50e-06Mitochondrial import inner membrane translocase subunit TIM17 OS=Sugiyamaella lignohabitans GN=TIM17 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0197
Predicted cleavage: 23

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR003397
    Mitochondrial inner membrane translocase subunit Tim17/Tim22/Tim23/peroxisomal protein PMP24
    1. PF02466 (Tim17)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. NON_CYTOPLASM... (N...)
  3. TMhelix
  4. TRANSMEMBRANE (Tran...)

Protein sequence

>MIA_06158_1
MSFLPGGSNGTNFGAYGGQSRPQSYMEMTPEQQAMAGAEAMMNFMQSCPGKSAMAGVTGFALGGVFGLFMASMSYDTPLG
STPTQFSDLPFKQQMKLQFTDMGKRSYSSAKNFGFIGLVFTGTECSIESLRAKTDIWNGVSAGCLTGGGLAIKSGPTSAL
MGCAAFAAFSTAIDLYMRRDSAPPPSTDEDE

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.