Protein
MCA_03849_1
Length
188 amino acids
Gene name: TIM22
Description: Mitochondrial import inner membrane translocase subunit TIM22
Browser: contigC:1288430-1289222-
RNA-seq: read pairs 2212, FPKM 144.6, percentile rank 84.4% (100% = highest expression)
Protein function
| Annotation: | TIM22 | Mitochondrial import inner membrane translocase subunit TIM22 | |
|---|---|---|---|
| KEGG: | K17790 | TIM22 | mitochondrial import inner membrane translocase subunit TIM22 |
| EGGNOG: | 0PQDK | TIM22 | Mitochondrial import inner membrane translocase subunit tim22 |
| SGD closest match: | S000002376 | TIM22 | Mitochondrial import inner membrane translocase subunit TIM22 |
| CGD closest match: | CAL0000200177 | TIM22 | Translocation channel protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_06158_1 | 85.94% | 192 | 7e-102 | MIA_06158_1 |
| A0A0J9YHH6_GEOCN | 77.89% | 190 | 5e-79 | Similar to Saccharomyces cerevisiae YDL217C TIM22 Essential core component of the mitochondrial TIM22 complex involved in insertion of polytopic proteins into the inner membrane OS=Geotrichum candidum GN=BN980_GECA01s04608g PE=4 SV=1 |
| A0A1E3PSG2_9ASCO | 74.44% | 180 | 1e-76 | Mitochondrial import inner membrane translocase subunit TIM22 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81288 PE=4 SV=1 |
| A0A1D8PI78_CANAL | 72.30% | 148 | 6e-75 | Translocation channel protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM22 PE=4 SV=1 |
| A0A060SZY7_BLAAD | 75.00% | 152 | 7e-70 | ARAD1C08316p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C08316g PE=4 SV=1 |
| UniRef50_Q75E80 | 61.45% | 166 | 2e-66 | Mitochondrial import inner membrane translocase subunit TIM22 n=85 Tax=Fungi TaxID=4751 RepID=TIM22_ASHGO |
| TIM22_YARLI | 74.66% | 146 | 1e-68 | Mitochondrial import inner membrane translocase subunit TIM22 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM22 PE=3 SV=2 |
| A0A1E4T9Y6_9ASCO | 69.18% | 146 | 3e-64 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3240 PE=4 SV=1 |
| TIM22_YEAST | 60.82% | 171 | 2e-60 | Mitochondrial import inner membrane translocase subunit TIM22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM22 PE=1 SV=1 |
| A0A161HFI3_9ASCO | 26.80% | 97 | 1e-06 | Mitochondrial import inner membrane translocase subunit TIM17 OS=Sugiyamaella lignohabitans GN=TIM17 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0258
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF02466 (Tim17)
-
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_03849_1 MSFMPGSSGYGAYGNGPSRPSYSEMTAEQQAQAGAEAMMNFMQSCPGKSVFAGVSGFALGGVFGLFMASMSYDTPLGQTP TQFSDLPFKQQMKLQFTDMGKRSWNSAKNFGFIGFLFTGTECSIESLRAKSDIWNGVSAGCITGGGLAIKSGPTNALMGC AAFAAFSTAIDLYLKRDSAPPPPTDEDE
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.