Protein
MIA_06074_1
Length
111 amino acids
Browser: contig10:151776-152163-
Protein function
EGGNOG: | 0PR3B | PGUG_05014 | Cytochrome c oxidase biogenesis protein Cmc1 like |
---|---|---|---|
SGD closest match: | S000007488 | CMC2 | COX assembly mitochondrial protein 2 |
CGD closest match: | CAL0000200024 | orf19.1336.2 | Uncharacterized protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XJ40_GEOCN | 56.383% | 94 | 6.98e-36 | Similar to Saccharomyces cerevisiae YBL059C-A CMC2 Protein of the mitochondrial intermembrane space with a role in respiratory chain complex assembly or maintenance OS=Geotrichum candidum GN=BN980_GECA18s00934g PE=4 SV=1 |
UniRef50_A0A0J9XJ40 | 56.383% | 94 | 1.43e-32 | Similar to Saccharomyces cerevisiae YBL059C-A CMC2 Protein of the mitochondrial intermembrane space with a role in respiratory chain complex assembly or maintenance n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XJ40_GEOCN |
MCA_00864_1 | 55.140% | 107 | 1.20e-30 | MCA_00864_1 |
A0A1E3PHH9_9ASCO | 45.161% | 93 | 5.63e-26 | UPF0287-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_34860 PE=4 SV=1 |
Q6C0R6_YARLI | 40.196% | 102 | 1.82e-23 | YALI0F22363p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F22363g PE=4 SV=1 |
A0A1D8PRB8_CANAL | 40.000% | 90 | 2.35e-19 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1336.2 PE=4 SV=1 |
COXM2_YEAST | 36.667% | 90 | 8.85e-19 | COX assembly mitochondrial protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMC2 PE=1 SV=1 |
A0A1E4TFD4_9ASCO | 40.000% | 80 | 4.10e-16 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2115 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0272
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_06074_1 MHPQFDERRISKCGKLIEALEECHRLGMVDRIFGACNTQKEALVLCLRQDRYDRQREHLEKSLQRNKEMRQKWKKIDEEE YGPGGYLREVEQKKKEGITAAPAATSNTQEQ
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.