Protein
MCA_00864_1
Length
108 amino acids
Gene name: CMC2
Description: COX assembly mitochondrial protein 2
Browser: contigA:2731411-2731813+
RNA-seq: read pairs 4385, FPKM 497.1, percentile rank 94.2% (100% = highest expression)
Protein function
| Annotation: | CMC2 | COX assembly mitochondrial protein 2 | |
|---|---|---|---|
| KEGG: | K18172 | CMC2 | COX assembly mitochondrial protein 2 |
| EGGNOG: | 0PR3B | PGUG_05014 | Cytochrome c oxidase biogenesis protein Cmc1 like |
| SGD closest match: | S000007488 | CMC2 | COX assembly mitochondrial protein 2 |
| CGD closest match: | CAL0000200024 | orf19.1336.2 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_06074_1 | 55.14% | 107 | 1e-29 | MIA_06074_1 |
| A0A1D8PRB8_CANAL | 49.49% | 99 | 3e-24 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1336.2 PE=4 SV=1 |
| A0A0J9XJ40_GEOCN | 47.87% | 94 | 9e-23 | Similar to Saccharomyces cerevisiae YBL059C-A CMC2 Protein of the mitochondrial intermembrane space with a role in respiratory chain complex assembly or maintenance OS=Geotrichum candidum GN=BN980_GECA18s00934g PE=4 SV=1 |
| UniRef50_A0A0J9XJ40 | 47.87% | 94 | 2e-19 | Similar to Saccharomyces cerevisiae YBL059C-A CMC2 Protein of the mitochondrial intermembrane space with a role in respiratory chain complex assembly or maintenance n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XJ40_GEOCN |
| A0A1E3PHH9_9ASCO | 46.15% | 91 | 2e-20 | UPF0287-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_34860 PE=4 SV=1 |
| COXM2_YEAST | 38.38% | 99 | 4e-14 | COX assembly mitochondrial protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMC2 PE=1 SV=1 |
| Q6C0R6_YARLI | 38.89% | 90 | 7e-14 | YALI0F22363p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F22363g PE=4 SV=1 |
| A0A1E4TFD4_9ASCO | 34.78% | 69 | 4e-10 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2115 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1856
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MCA_00864_1 MHPQLDEKRILRCGKIIEALEECHRSGMMHQVFGGCNNQKEALVECLHSQRMDVQKEHFLKAKEKRKAMLEKWKKLEEEE YGKDNYLKKVSEVKRAQRQAPQTPATTE
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.