Protein

MIA_06058_1

Length
252 amino acids


Browser: contig10:99036-99795-

Protein function

EGGNOG:0PJ09mitochondrial 37S ribosomal protein MRPS17
SGD closest match:S000004800MRPS1737S ribosomal protein S17, mitochondrial
CGD closest match:CAL0000180848orf19.4176Mitochondrial 37S ribosomal protein MRPS17

Protein alignments

%idAln lengthE-value
A0A0J9XFV6_GEOCN55.731%2531.12e-97Similar to Saccharomyces cerevisiae YMR188C MRPS17 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA12s02001g PE=4 SV=1
UniRef50_A0A0J9XFV655.731%2532.29e-94Similar to Saccharomyces cerevisiae YMR188C MRPS17 Mitochondrial ribosomal protein of the small subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XFV6_GEOCN
MCA_05444_153.571%2521.61e-89MCA_05444_1
A0A167EFZ9_9ASCO42.510%2472.08e-63Mitochondrial 37S ribosomal protein MRPS17 OS=Sugiyamaella lignohabitans GN=MRPS17 PE=4 SV=1
A0A1E3PTA0_9ASCO39.113%2484.78e-48Nucleic acid-binding protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81533 PE=4 SV=1
A0A060SYV5_BLAAD35.685%2411.27e-43ARAD1C03872p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C03872g PE=4 SV=1
RT17_YEAST36.475%2445.82e-3837S ribosomal protein S17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS17 PE=1 SV=1
Q6CCN7_YARLI31.364%2201.27e-30YALI0C07887p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C07887g PE=4 SV=1
Q59SJ6_CANAL40.994%1613.72e-27Mitochondrial 37S ribosomal protein MRPS17 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4176 PE=4 SV=1
A0A1E4TGS2_9ASCO33.061%2454.70e-26Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_113337 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9778

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 252

Detailed signature matches

    1. PF00366 (Ribosomal_S17)
    1. SSF50249 (Nucleic a...)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MIA_06058_1
MTRQNFVGMVVSHGKMDKTVKVRVQRIKFNKLVNKNVVRFTDFLVHDEANKCKEGDVVRIQYVRPLSARKSFAVTEILKN
KGLSWIKYREDAPSVVAAEELSKITQYKLDRERRLGLDGTPTVSEQINDLRTAYNTQNFVPENARTEEQKEAVAKIIAKY
TPDGFLPSFASGPLYDLPIDTLREELKALNGTIEQASFAKYASNVISEEPARADAILREMGKTDPLAVPRNIKKNLLMKY
FVKTLGNEKQHA

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome