Protein

MCA_05444_1

Length
236 amino acids


Gene name: MRPS17

Description: 37S ribosomal protein S17, mitochondrial

Browser: contigD:1340584-1341295+

RNA-seq: read pairs 3425, FPKM 178.6, percentile rank 86.7% (100% = highest expression)

Protein function

Annotation:MRPS1737S ribosomal protein S17, mitochondrial
KEGG:K02961RP-S17 small subunit ribosomal protein S17
EGGNOG:0PJ09mitochondrial 37S ribosomal protein MRPS17
SGD closest match:S000004800MRPS1737S ribosomal protein S17, mitochondrial
CGD closest match:CAL0000180848orf19.4176Mitochondrial 37S ribosomal protein MRPS17

Protein alignments

%idAln lengthE-value
MIA_06058_153.57%2527e-81MIA_06058_1
A0A0J9XFV6_GEOCN53.41%2496e-78Similar to Saccharomyces cerevisiae YMR188C MRPS17 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA12s02001g PE=4 SV=1
UniRef50_A0A0J9XFV653.41%2491e-74Similar to Saccharomyces cerevisiae YMR188C MRPS17 Mitochondrial ribosomal protein of the small subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XFV6_GEOCN
A0A167EFZ9_9ASCO47.88%2369e-63Mitochondrial 37S ribosomal protein MRPS17 OS=Sugiyamaella lignohabitans GN=MRPS17 PE=4 SV=1
A0A1E3PTA0_9ASCO41.60%2383e-41Nucleic acid-binding protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81533 PE=4 SV=1
A0A060SYV5_BLAAD38.56%2367e-35ARAD1C03872p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C03872g PE=4 SV=1
RT17_YEAST37.96%2452e-3437S ribosomal protein S17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS17 PE=1 SV=1
Q59SJ6_CANAL54.17%962e-27Mitochondrial 37S ribosomal protein MRPS17 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4176 PE=4 SV=1
Q6CCN7_YARLI32.70%2116e-25YALI0C07887p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C07887g PE=4 SV=1
A0A1E4TGS2_9ASCO51.22%824e-21Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_113337 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9957

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 236

Detailed signature matches

    1. PF00366 (Ribosomal_S17)
    1. SSF50249 (Nucleic a...)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_05444_1
MVRQNFVGTVISQGKMNKTIKVRVQRVKFNKLVNKNVIRFTDFLVHDEVNKCNEGDVVRIQYVRPLSARKSFAVTEILTN
KGLSWLKYREEAPKIVAKEELEKILKYKEETKKRTGTDENGRQFNVITAQLDEQRKKLLSSVGGSRPQEIPIMELDITAM
RKKLEELNLDITNSSFSATAKDLVKNNPKKADQILTEMGKADPSQLSNNIKKNLLMKYFVKNVSKDKLKAESEASA

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome