Protein
MCA_05444_1
Length
236 amino acids
Gene name: MRPS17
Description: 37S ribosomal protein S17, mitochondrial
Browser: contigD:1340584-1341295+
RNA-seq: read pairs 3425, FPKM 178.6, percentile rank 86.7% (100% = highest expression)
Protein function
Annotation: | MRPS17 | 37S ribosomal protein S17, mitochondrial | |
---|---|---|---|
KEGG: | K02961 | RP-S17 | small subunit ribosomal protein S17 |
EGGNOG: | 0PJ09 | mitochondrial 37S ribosomal protein MRPS17 | |
SGD closest match: | S000004800 | MRPS17 | 37S ribosomal protein S17, mitochondrial |
CGD closest match: | CAL0000180848 | orf19.4176 | Mitochondrial 37S ribosomal protein MRPS17 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_06058_1 | 53.57% | 252 | 7e-81 | MIA_06058_1 |
A0A0J9XFV6_GEOCN | 53.41% | 249 | 6e-78 | Similar to Saccharomyces cerevisiae YMR188C MRPS17 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA12s02001g PE=4 SV=1 |
UniRef50_A0A0J9XFV6 | 53.41% | 249 | 1e-74 | Similar to Saccharomyces cerevisiae YMR188C MRPS17 Mitochondrial ribosomal protein of the small subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XFV6_GEOCN |
A0A167EFZ9_9ASCO | 47.88% | 236 | 9e-63 | Mitochondrial 37S ribosomal protein MRPS17 OS=Sugiyamaella lignohabitans GN=MRPS17 PE=4 SV=1 |
A0A1E3PTA0_9ASCO | 41.60% | 238 | 3e-41 | Nucleic acid-binding protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81533 PE=4 SV=1 |
A0A060SYV5_BLAAD | 38.56% | 236 | 7e-35 | ARAD1C03872p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C03872g PE=4 SV=1 |
RT17_YEAST | 37.96% | 245 | 2e-34 | 37S ribosomal protein S17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS17 PE=1 SV=1 |
Q59SJ6_CANAL | 54.17% | 96 | 2e-27 | Mitochondrial 37S ribosomal protein MRPS17 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4176 PE=4 SV=1 |
Q6CCN7_YARLI | 32.70% | 211 | 6e-25 | YALI0C07887p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C07887g PE=4 SV=1 |
A0A1E4TGS2_9ASCO | 51.22% | 82 | 4e-21 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_113337 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9957
Protein family membership
- Ribosomal protein S17/S11 (IPR000266)
Domains and repeats
-
Domain
1
50
100
150
200
236
Detailed signature matches
-
-
SSF50249 (Nucleic a...)
-

Unintegrated signatures
Protein sequence
>MCA_05444_1 MVRQNFVGTVISQGKMNKTIKVRVQRVKFNKLVNKNVIRFTDFLVHDEVNKCNEGDVVRIQYVRPLSARKSFAVTEILTN KGLSWLKYREEAPKIVAKEELEKILKYKEETKKRTGTDENGRQFNVITAQLDEQRKKLLSSVGGSRPQEIPIMELDITAM RKKLEELNLDITNSSFSATAKDLVKNNPKKADQILTEMGKADPSQLSNNIKKNLLMKYFVKNVSKDKLKAESEASA
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome