Protein
MIA_06034_1
Length
85 amino acids
Browser: contig10:50731-51070-
Protein function
| SGD closest match: | S000028512 | PCC1 | EKC/KEOPS complex subunit PCC1 |
|---|---|---|---|
| CGD closest match: | CAL0000189965 | orf19.2907.1 | Chromatin DNA-binding EKC/KEOPS complex subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_03713_1 | 53.750% | 80 | 1.03e-30 | MCA_03713_1 |
| A0A1E3PJ63_9ASCO | 44.186% | 86 | 5.11e-23 | Transcription factor Pcc1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52047 PE=4 SV=1 |
| UniRef50_A0A1E3PJ63 | 44.186% | 86 | 1.39e-19 | Transcription factor Pcc1 n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A1E3PJ63_9ASCO |
| A0A060T1M9_BLAAD | 39.286% | 84 | 6.59e-23 | ARAD1C25916p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C25916g PE=4 SV=1 |
| A0A0J9X350_GEOCN | 47.143% | 70 | 4.47e-18 | Similar to Saccharomyces cerevisiae YKR095W-A PCC1 Component of the EKC/KEOPS protein complex OS=Geotrichum candidum GN=BN980_GECA01s00934g PE=4 SV=1 |
| B5RSL9_YARLI | 34.615% | 78 | 9.70e-16 | YALI0F21373p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F21373g PE=4 SV=1 |
| PCC1_YEAST | 36.709% | 79 | 9.42e-14 | EKC/KEOPS complex subunit PCC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCC1 PE=1 SV=1 |
| A0A1D8PMJ7_CANAL | 32.500% | 80 | 6.07e-13 | Chromatin DNA-binding EKC/KEOPS complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2907.1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0380
Protein family membership
- CTAG/Pcc1 family (IPR015419)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF09341 (Pcc1)
-
Protein sequence
>MIA_06034_1 MSQLPYKLTLRIPFDSEKHANVVFQSLRPDKELRPDQVSRALSVEGPVLVADYAASSDRVLRVTINALLDSVAMLVEAID GLEEI
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.