Protein
MCA_03713_1
Length
87 amino acids
Gene name: PCC1
Description: EKC/KEOPS complex subunit PCC1
Browser: contigC:854561-854888-
RNA-seq: read pairs 345, FPKM 48.4, percentile rank 64.7% (100% = highest expression)
Protein function
| Annotation: | PCC1 | EKC/KEOPS complex subunit PCC1 | |
|---|---|---|---|
| KEGG: | K15902 | PCC1 | EKC/KEOPS complex subunit PCC1/LAGE3 |
| EGGNOG: | 0PSAG | PCC1 | polarized growth chromatin-associated controller |
| SGD closest match: | S000028512 | PCC1 | EKC/KEOPS complex subunit PCC1 |
| CGD closest match: | CAL0000189965 | orf19.2907.1 | Chromatin DNA-binding EKC/KEOPS complex subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_06034_1 | 53.75% | 80 | 1e-29 | MIA_06034_1 |
| A0A060T1M9_BLAAD | 50.00% | 78 | 1e-25 | ARAD1C25916p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C25916g PE=4 SV=1 |
| A0A1E3PJ63_9ASCO | 46.91% | 81 | 3e-21 | Transcription factor Pcc1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52047 PE=4 SV=1 |
| UniRef50_A0A1E3PJ63 | 46.91% | 81 | 7e-18 | Transcription factor Pcc1 n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A1E3PJ63_9ASCO |
| B5RSL9_YARLI | 41.03% | 78 | 9e-16 | YALI0F21373p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F21373g PE=4 SV=1 |
| A0A0J9X350_GEOCN | 43.84% | 73 | 2e-14 | Similar to Saccharomyces cerevisiae YKR095W-A PCC1 Component of the EKC/KEOPS protein complex OS=Geotrichum candidum GN=BN980_GECA01s00934g PE=4 SV=1 |
| PCC1_YEAST | 37.66% | 77 | 3e-12 | EKC/KEOPS complex subunit PCC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCC1 PE=1 SV=1 |
| A0A1D8PMJ7_CANAL | 30.77% | 78 | 5e-12 | Chromatin DNA-binding EKC/KEOPS complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2907.1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0312
Protein family membership
- CTAG/Pcc1 family (IPR015419)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF09341 (Pcc1)
-
Protein sequence
>MCA_03713_1 MSNTTKSHKLTIDLPFDTEDHARIALQSIEPDKELKPDQVSKKLGVKGTHLIADFEAISDRVLRVTVNSFMDSISLVIET IEELENL
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.