Protein

MIA_06006_1

Length
104 amino acids

Browser: contig09:951001-951316+

Protein function

EGGNOG:0PQT5TRX2Thioredoxin
SGD closest match:S000004033TRX1Thioredoxin-1
CGD closest match:CAL0000180451TRX1Thioredoxin

Protein alignments

%idAln lengthE-value
MCA_00345_156.863%1022.67e-40MCA_00345_1
Q6C399_YARLI56.863%1021.41e-40Thioredoxin OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F01496g PE=3 SV=1
UniRef50_Q6C39956.863%1023.26e-37Thioredoxin n=3 Tax=Dipodascaceae TaxID=34353 RepID=Q6C399_YARLI
A0A1E4TI34_9ASCO56.000%1001.92e-39Thioredoxin OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3115 PE=3 SV=1
A0A167EUJ2_9ASCO57.292%962.44e-38Thioredoxin OS=Sugiyamaella lignohabitans GN=TRX1 PE=3 SV=1
A0A1E3PG15_9ASCO55.102%988.09e-38Thioredoxin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47429 PE=3 SV=1
A0A0J9XEQ5_GEOCN56.122%987.04e-37Thioredoxin OS=Geotrichum candidum GN=BN980_GECA12s02155g PE=3 SV=1
TRX1_YEAST57.143%981.28e-36Thioredoxin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX1 PE=1 SV=3
A0A060T4G9_BLAAD49.038%1041.72e-36Thioredoxin OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A17292g PE=3 SV=1
A0A1D8PU69_CANAL51.579%952.57e-35Thioredoxin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRX1 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0646

Protein family membership

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 70 80 90 104

Detailed signature matches

  1. Family IPR005746
    Thioredoxin
    1. TIGR01068
    2. PIRSF000077 (Thiore...)
  2. Domain IPR012336
    Thioredoxin-like fold
    1. SSF52833 (Thioredox...)
  3. Domain IPR013766
    Thioredoxin domain
    1. PF00085 (Thioredoxin)
    2. PS51352 (THIOREDOXIN_2)
  4. SITE IPR017937
    Thioredoxin, conserved site
    1. PS00194 (THIOREDOXIN_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.30.10
  2. PR00421 (THIOREDOXIN)
  3. SFLDG00337 (Thiored...)
  4. SFLDG00345 (PDI-like)
  5. cd02947 (TRX_family)

Residue annotation

  1. catalytic residues...
  2. SFLDG00337

Protein sequence

>MIA_06006_1
MAVTQVHSASEFNEAIKYDGLTVVDFFATWCGPCKAIAPVIEKLSTANPNIKFIKVDVDELASVSAEVGVSAMPTFIFYK
NGEKVHSVVGANTRKIEEGINQYK

GO term prediction

Biological Process

GO:0006662 glycerol ether metabolic process
GO:0045454 cell redox homeostasis

Molecular Function

GO:0015035 protein disulfide oxidoreductase activity

Cellular Component

None predicted.