Protein

MIA_05955_1

Length
234 amino acids

Browser: contig09:804900-805605+

Protein function

EGGNOG:0PMR5MGE1Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner
SGD closest match:S000005758MGE1GrpE protein homolog, mitochondrial
CGD closest match:CAL0000197365MGE1GrpE protein homolog

Protein alignments

%idAln lengthE-value
MCA_00474_168.182%1982.70e-91MCA_00474_1
A0A0J9X662_GEOCN71.257%1672.54e-85GrpE protein homolog OS=Geotrichum candidum GN=BN980_GECA04s01913g PE=3 SV=1
A0A167F187_9ASCO67.066%1671.32e-78Mge1p OS=Sugiyamaella lignohabitans GN=MGE1 PE=3 SV=1
A0A060T7V7_BLAAD66.879%1571.04e-74GrpE protein homolog OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C25058g PE=3 SV=1
A0A1E3PFA3_9ASCO64.634%1647.45e-75GrpE protein homolog OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47945 PE=3 SV=1
Q6CBI2_YARLI61.212%1651.05e-71GrpE protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C18513g PE=3 SV=1
UniRef50_U4LKJ159.756%1642.08e-63GrpE protein homolog n=6 Tax=Pezizomycotina TaxID=147538 RepID=U4LKJ1_PYROM
GRPE_YEAST54.545%1981.69e-64GrpE protein homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGE1 PE=1 SV=1
A0A1E4TEF2_9ASCO55.488%1641.94e-62GrpE protein homolog (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_15902 PE=3 SV=1
Q5A9E1_CANAL63.265%1476.99e-56GrpE protein homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MGE1 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9905
Predicted cleavage: 39

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 234

Detailed signature matches

  1. Family IPR000740
    GrpE nucleotide exchange factor
    1. MF_01151 (GrpE)
    2. PR00773 (GRPEPROTEIN)
    3. PS01071 (GRPE)
    4. cd00446 (GrpE)
    5. PF01025 (GrpE)
  2. Domain IPR013805
    GrpE nucleotide exchange factor, coiled-coil
    1. G3DSA:3.90.20.20
  3. Domain IPR009012
    GrpE nucleotide exchange factor, head
    1. SSF51064 (Head doma...)
    2. G3DSA:2.30.22.10
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. NON_CYTOPLASM... (N...)
  3. SIGNAL_PEPTIDE (Sig...)
  4. SIGNAL_PEPTID... (S...)
  5. SIGNAL_PEPTID... (S...)
  6. SIGNAL_PEPTID... (S...)
  7. SSF58014 (Coiled-co...)
  8. mobidb-lite (disord...)

Residue annotation

  1. dimer interface cd...
  2. Hsp70 (ATPase doma...

Protein sequence

>MIA_05955_1
MLRSIIARTPRRTLAVAAARPVAGAAAMHVAMPALRFYSDKAEKSDEKPAEEGASAADAEAGEVHPLQKELDTCKSKLEE
KDKQAAQFKDKYLRAVADFQNLQTRTVKEVADAKDYALTKFAKDLLESVDNFDRALAVVAEDKRNDPVEHKEIIDLYEGV
KMTQNVFEKTLQKYGIAKINPIGEKFDPNLHEATFQAPQADKEPGTVFFVQQTGFTLNGRVLRAAKVGIVLEQE

GO term prediction

Biological Process

GO:0006457 protein folding

Molecular Function

GO:0000774 adenyl-nucleotide exchange factor activity
GO:0042803 protein homodimerization activity
GO:0051087 chaperone binding

Cellular Component

None predicted.