Protein
MCA_00474_1
Length
237 amino acids
Gene name: MGE1
Description: GrpE protein homolog, mitochondrial
Browser: contigA:1486712-1487426+
RNA-seq: read pairs 4058, FPKM 210.7, percentile rank 88.7% (100% = highest expression)
Protein function
| Annotation: | MGE1 | GrpE protein homolog, mitochondrial | |
|---|---|---|---|
| KEGG: | K03687 | GRPE | molecular chaperone GrpE |
| EGGNOG: | 0PMR5 | MGE1 | Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner |
| SGD closest match: | S000005758 | MGE1 | GrpE protein homolog, mitochondrial |
| CGD closest match: | CAL0000197365 | MGE1 | GrpE protein homolog |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05955_1 | 62.82% | 234 | 9e-92 | MIA_05955_1 |
| A0A0J9X662_GEOCN | 70.48% | 166 | 2e-79 | GrpE protein homolog OS=Geotrichum candidum GN=BN980_GECA04s01913g PE=3 SV=1 |
| A0A1E3PFA3_9ASCO | 64.85% | 165 | 2e-72 | GrpE protein homolog OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47945 PE=3 SV=1 |
| A0A167F187_9ASCO | 63.80% | 163 | 8e-71 | Mge1p OS=Sugiyamaella lignohabitans GN=MGE1 PE=3 SV=1 |
| A0A060T7V7_BLAAD | 58.82% | 221 | 3e-71 | GrpE protein homolog OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C25058g PE=3 SV=1 |
| UniRef50_U4LKJ1 | 59.88% | 162 | 4e-61 | GrpE protein homolog n=6 Tax=Pezizomycotina TaxID=147538 RepID=U4LKJ1_PYROM |
| Q6CBI2_YARLI | 56.80% | 169 | 4e-64 | GrpE protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C18513g PE=3 SV=1 |
| GRPE_YEAST | 46.61% | 236 | 2e-61 | GrpE protein homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGE1 PE=1 SV=1 |
| A0A1E4TEF2_9ASCO | 55.90% | 161 | 8e-59 | GrpE protein homolog (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_15902 PE=3 SV=1 |
| Q5A9E1_CANAL | 59.46% | 148 | 1e-54 | GrpE protein homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MGE1 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9894
Predicted cleavage: 39
Protein family membership
- GrpE nucleotide exchange factor (IPR000740)
Domains and repeats
-
Domain
1
50
100
150
200
237
Detailed signature matches
-
-
SSF51064 (Head doma...)
-
-
no IPR
Unintegrated signatures
-
-
SSF58014 (Coiled-co...)
-
mobidb-lite (disord...)
Residue annotation
-
dimer interface cd...
-
Hsp70 (ATPase doma...
Protein sequence
>MCA_00474_1 MLRNYIAKSARAFRPVPAVTFYRAAAQPSLRSNQLRFYSEEKKANEESPKEATEEGAEKTQAETETEKSPAEQELNECLT KLEEKDKLAAQLKDKYLRSVADFQNLQVRTAKEVQDAKDYALRKFAKDLLESVDNFDRALSVVDEDKKKDPATHKELIDL YEGIKMTQAVFEKTLEKHGITKINPIDEPFDPNFHEATFQAPQPGKKPGHVFYVQQTGFMYNGKVLRAAKVGVVPQE
GO term prediction
Biological Process
GO:0006457 protein folding
Molecular Function
GO:0000774 adenyl-nucleotide exchange factor activity
GO:0042803 protein homodimerization activity
GO:0051087 chaperone binding
Cellular Component
None predicted.