Protein

MIA_05888_1

Length
122 amino acids

Browser: contig09:613331-613700-

Protein function

EGGNOG:0PQMEMRPS16mitochondrial 37S ribosomal protein MRPS16
SGD closest match:S000005934MRPS1637S ribosomal protein S16, mitochondrial
CGD closest match:CAL0000194758orf19.7012Mitochondrial 37S ribosomal protein MRPS16

Protein alignments

%idAln lengthE-value
MCA_04480_176.991%1139.32e-59MCA_04480_1
A0A0J9X990_GEOCN71.074%1211.44e-58Similar to Saccharomyces cerevisiae YPL013C MRPS16 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA05s06060g PE=3 SV=1
A0A167EUA2_9ASCO64.754%1221.37e-54Mitochondrial 37S ribosomal protein MRPS16 OS=Sugiyamaella lignohabitans GN=MRPS16 PE=3 SV=1
A0A060SWR4_BLAAD68.142%1133.96e-51ARAD1A07348p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A07348g PE=3 SV=1
UniRef50_A0A099P13358.333%1081.35e-37Uncharacterized protein n=2 Tax=Pichia kudriavzevii TaxID=4909 RepID=A0A099P133_PICKU
RT16_YEAST57.282%1031.82e-4037S ribosomal protein S16, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS16 PE=1 SV=1
Q6C6G7_YARLI57.576%992.45e-38YALI0E09691p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E09691g PE=3 SV=1
A0A1D8PQR2_CANAL51.240%1211.45e-34Mitochondrial 37S ribosomal protein MRPS16 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.7012 PE=3 SV=1
A0A1E3PNJ9_9ASCO52.679%1129.38e-35Ribosomal protein S16 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82553 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9875
Predicted cleavage: 28

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 122

Detailed signature matches

  1. Family IPR000307
    Ribosomal protein S16
    1. PF00886 (Ribosomal_S16)
    2. TIGR00002
    3. MF_00385 (Ribosomal...)
  2. Domain IPR023803
    Ribosomal protein S16 domain
    1. G3DSA:3.30.13...
    2. SSF54565 (Ribosomal...)
  3. SITE IPR020592
    Ribosomal protein S16, conserved site
    1. PS00732 (RIBOSOMAL_S16)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_05888_1
MKGSVRIRLARFGRKFQPVYNIVVARARSGRNKLPIEVIGTYNPIPAPLTLEQRQAGVRPIKEIHLDTDRSKYWLGVGAQ
PTEPVARLFRKLGLLSPVWPSPTHGPKIPVRETVSESRFVEE

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome