Protein

MCA_04480_1

Length
144 amino acids


Gene name: MRPS16

Description: 37S ribosomal protein S16, mitochondrial

Browser: contigC:3147797-3148320+

RNA-seq: read pairs 2634, FPKM 224.5, percentile rank 89.3% (100% = highest expression)

Protein function

Annotation:MRPS1637S ribosomal protein S16, mitochondrial
KEGG:K02959RP-S16 small subunit ribosomal protein S16
EGGNOG:0PQMEMRPS16mitochondrial 37S ribosomal protein MRPS16
SGD closest match:S000005934MRPS1637S ribosomal protein S16, mitochondrial
CGD closest match:CAL0000194758orf19.7012Mitochondrial 37S ribosomal protein MRPS16

Protein alignments

%idAln lengthE-value
A0A0J9X990_GEOCN80.00%1203e-66Similar to Saccharomyces cerevisiae YPL013C MRPS16 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA05s06060g PE=3 SV=1
MIA_05888_176.99%1133e-57MIA_05888_1
A0A167EUA2_9ASCO73.21%1123e-56Mitochondrial 37S ribosomal protein MRPS16 OS=Sugiyamaella lignohabitans GN=MRPS16 PE=3 SV=1
A0A060SWR4_BLAAD69.75%1192e-53ARAD1A07348p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A07348g PE=3 SV=1
UniRef50_A0A1Q2YES856.30%1193e-39Uncharacterized protein n=1 Tax=Pichia membranifaciens TaxID=4926 RepID=A0A1Q2YES8_9ASCO
RT16_YEAST62.24%984e-4037S ribosomal protein S16, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS16 PE=1 SV=1
Q6C6G7_YARLI59.00%1001e-38YALI0E09691p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E09691g PE=3 SV=1
A0A1E3PNJ9_9ASCO58.00%1002e-32Ribosomal protein S16 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82553 PE=3 SV=1
A0A1D8PQR2_CANAL43.94%1321e-31Mitochondrial 37S ribosomal protein MRPS16 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.7012 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9834
Predicted cleavage: 28

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 144

Detailed signature matches

    1. PF00886 (Ribosomal_S16)
    2. MF_00385 (Ribosomal...)
    1. SSF54565 (Ribosomal...)
    1. PS00732 (RIBOSOMAL_S16)

Protein sequence

>MCA_04480_1
MKGSVRIRLARFGRKFAPLYNIVVARARSGRNKLPIEVIGTYNPIPTPLTEQQKAEGHIRPIKDIALDFDRARYWIGVGA
QPTEVVARLFRKAGILHPEWPAPHVGPKIPERKVEISAQGDVPRDFLKIIQDTTKLKSSSEKEN

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome