Protein

MIA_05854_1

Length
70 amino acids

Browser: contig09:528366-528642-

Protein function

EGGNOG:0PTCUribosomal protein
SGD closest match:S000007224RTC654S ribosomal protein RTC6, mitochondrial
CGD closest match:CAL0000201459orf19.760Ribosomal protein

Protein alignments

%idAln lengthE-value
MCA_05472_174.648%719.38e-36MCA_05472_1
A0A0J9XKN7_GEOCN63.380%713.07e-28Ribosomal protein OS=Geotrichum candidum GN=BN980_GECA24s00252g PE=3 SV=1
UniRef50_A0A0J9XKN763.380%716.27e-25Ribosomal protein n=5 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XKN7_GEOCN
A0A060TBP4_BLAAD57.143%702.14e-21Ribosomal protein OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D33638g PE=3 SV=1
RTC6_YEAST75.000%403.50e-1954S ribosomal protein RTC6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTC6 PE=1 SV=1
Q59VH3_CANAL46.970%663.19e-16Ribosomal protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.760 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9910
Predicted cleavage: 52

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR000473
    Ribosomal protein L36
    1. TIGR01022
    2. PF00444 (Ribosomal_L36)
    3. MF_00251 (Ribosomal...)
    4. SSF57840 (Ribosomal...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PD002101

Protein sequence

>MIA_05854_1
MWALIRNSFASVRPALNNPSFLQNPILSQVRGMKIKSAVKKFCSGCYIVRRKGRTYVYCKSNPKHKQRQG

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome