Protein
MIA_05854_1
Length
70 amino acids
Browser: contig09:528366-528642-
Protein function
EGGNOG: | 0PTCU | ribosomal protein | |
---|---|---|---|
SGD closest match: | S000007224 | RTC6 | 54S ribosomal protein RTC6, mitochondrial |
CGD closest match: | CAL0000201459 | orf19.760 | Ribosomal protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_05472_1 | 74.648% | 71 | 9.38e-36 | MCA_05472_1 |
A0A0J9XKN7_GEOCN | 63.380% | 71 | 3.07e-28 | Ribosomal protein OS=Geotrichum candidum GN=BN980_GECA24s00252g PE=3 SV=1 |
UniRef50_A0A0J9XKN7 | 63.380% | 71 | 6.27e-25 | Ribosomal protein n=5 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XKN7_GEOCN |
A0A060TBP4_BLAAD | 57.143% | 70 | 2.14e-21 | Ribosomal protein OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D33638g PE=3 SV=1 |
RTC6_YEAST | 75.000% | 40 | 3.50e-19 | 54S ribosomal protein RTC6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTC6 PE=1 SV=1 |
Q59VH3_CANAL | 46.970% | 66 | 3.19e-16 | Ribosomal protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.760 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9910
Predicted cleavage: 52
Protein family membership
- Ribosomal protein L36 (IPR000473)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MIA_05854_1 MWALIRNSFASVRPALNNPSFLQNPILSQVRGMKIKSAVKKFCSGCYIVRRKGRTYVYCKSNPKHKQRQG
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome