Protein

MCA_05472_1

Length
70 amino acids

Gene name: RTC6

Description: 54S ribosomal protein RTC6, mitochondrial

Browser: contigD:1408969-1409258-

RNA-seq: read pairs 1433, FPKM 249.4, percentile rank 90.4% (100% = highest expression)

Protein function

Annotation:RTC654S ribosomal protein RTC6, mitochondrial
KEGG:K02919RP-L36 large subunit ribosomal protein L36
EGGNOG:0PTCUribosomal protein
SGD closest match:S000007224RTC654S ribosomal protein RTC6, mitochondrial
CGD closest match:CAL0000201459orf19.760Ribosomal protein

Protein alignments

%idAln lengthE-value
MIA_05854_174.65%712e-34MIA_05854_1
A0A0J9XKN7_GEOCN68.57%701e-29Ribosomal protein OS=Geotrichum candidum GN=BN980_GECA24s00252g PE=3 SV=1
UniRef50_A0A0J9XKN768.57%703e-26Ribosomal protein n=5 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XKN7_GEOCN
A0A060TBP4_BLAAD64.29%702e-23Ribosomal protein OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D33638g PE=3 SV=1
RTC6_YEAST60.66%611e-1954S ribosomal protein RTC6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTC6 PE=1 SV=1
Q59VH3_CANAL52.86%708e-17Ribosomal protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.760 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9963
Predicted cleavage: 52

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR000473
    Ribosomal protein L36
    1. TIGR01022
    2. PF00444 (Ribosomal_L36)
    3. MF_00251 (Ribosomal...)
    4. SSF57840 (Ribosomal...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PD002101

Protein sequence

>MCA_05472_1
MWSLLRNSFAAAARPGFASSFIQQPFLTQIRGMKVRSSVKKFCSGCYIVRRKGRTYVYCKSNPKHKQRQG

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome