Protein

MIA_05776_1

Length
482 amino acids

Browser: contig09:294445-295894+

Protein function

EGGNOG:0PGG7TIM50Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Required to direct preproteins in transit and direct them to the channel protein TIM23, and possibly facilitates transfer of the translocating proteins from the TOM complex to the TIM23 complex
SGD closest match:S000005984TIM50Mitochondrial import inner membrane translocase subunit TIM50
CGD closest match:CAL0000183476TIM50Mitochondrial import inner membrane translocase subunit TIM50

Protein alignments

%idAln lengthE-value
MCA_00834_175.926%3780.0MCA_00834_1
A0A0J9XFT1_GEOCN69.415%3760.0Similar to Saccharomyces cerevisiae YPL063W TIM50 Essential component of the Translocase of the Inner Mitochondrial membrane (TIM23 complex) OS=Geotrichum candidum GN=BN980_GECA14s00241g PE=4 SV=1
A0A167FN24_9ASCO63.807%3736.14e-165Tim50p OS=Sugiyamaella lignohabitans GN=TIM50 PE=4 SV=1
UniRef50_A0A167FN2463.807%3731.69e-161Tim50p n=5 Tax=Saccharomycetales TaxID=4892 RepID=A0A167FN24_9ASCO
A0A060T598_BLAAD61.170%3761.93e-161ARAD1C03916p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C03916g PE=4 SV=1
A0A1E3PLQ3_9ASCO57.520%3791.04e-148NIF-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82133 PE=4 SV=1
TIM50_YARLI50.811%3701.59e-125Mitochondrial import inner membrane translocase subunit TIM50 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM50 PE=3 SV=1
TIM50_CANAL52.368%3808.87e-115Mitochondrial import inner membrane translocase subunit TIM50 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM50 PE=3 SV=1
TIM50_YEAST50.681%3671.31e-105Mitochondrial import inner membrane translocase subunit TIM50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM50 PE=1 SV=1
A0A1E4TBL4_9ASCO44.928%3455.08e-88Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_20435 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9886
Predicted cleavage: 42

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 450 482

Detailed signature matches

  1. Domain IPR023214
    HAD-like domain
    1. SSF56784 (HAD-like)
    2. G3DSA:3.40.50...
  2. Domain IPR004274
    FCP1 homology domain
    1. SM00577 (forpap2)
    2. PS50969 (FCP1)
    3. PF03031 (NIF)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. NON_CYTOPLASM... (N...)
  3. TRANSMEMBRANE (Tran...)
  4. cd07521 (HAD_FCP1-like)
  5. mobidb-lite (disord...)

Residue annotation

  1. active site cd07521
  2. HAD signature moti...
  3. HAD signature moti...

Protein sequence

>MIA_05776_1
MNQLLRSLGQTSRMVAARSSAAGRLSAMSIRPATMTTARLYSKDTSKSSLLSDDILEKAGINSSSSAKTSSSGNQTSDSQ
SDSSPHTTEEQRQHWKDTAKRASNKTTTDLKREKHSNYFYLASLGALVGGSIYLARDWDDAEEELKNKDVPNGYTPELCW
ARFKTRLGDVFGFFNEPAFDQLLPDPLPAPYGRHVTLVLGLDDVLVHSEWSRQHGWRTAKRPGLDYFLGYLSQYYEVVVF
SSNYMMNSEKVVDGIDRYKAFVTYRLFRENTTYRNGKIIKDLSRLNRDLGKVIMIDCREDSFALQPENAIQLKPWEGNAD
DKELIKLIPFLEWLATQPIKDVRPIIKSFEDKYIPDEYQRREAIVRKKFEEEWYAEQEKRQKNNWAAAFLGIKPPTQAAP
MMPQDYIRQEAQKGYESFQKNLAEHGEKFLAEEKENEKRMLSEQKFTLNKLVTEGLPKPEDIQAAAYAAELKLKEEQQKE
FK

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.