Protein

MIA_05757_1

Length
152 amino acids

Browser: contig09:247264-247723-

Protein function

SGD closest match:S000004663SEN15tRNA-splicing endonuclease subunit SEN15

Protein alignments

%idAln lengthE-value
A0A0J9XBP1_GEOCN42.177%1472.78e-32Similar to Saccharomyces cerevisiae YMR059W SEN15 Subunit of the tRNA splicing endonuclease OS=Geotrichum candidum GN=BN980_GECA08s02100g PE=4 SV=1
UniRef50_A0A0J9XBP142.177%1475.69e-29Similar to Saccharomyces cerevisiae YMR059W SEN15 Subunit of the tRNA splicing endonuclease n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XBP1_GEOCN
MCA_00248_137.580%1572.24e-30MCA_00248_1
A0A167FU08_9ASCO34.815%1351.35e-21Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_3342 PE=4 SV=1
A0A1E3PK49_9ASCO33.758%1575.36e-21Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51073 PE=4 SV=1
A0A060T8A5_BLAAD31.111%1357.74e-21ARAD1C27852p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C27852g PE=4 SV=1
Q6C7N9_YARLI28.148%1353.86e-18YALI0D26576p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D26576g PE=4 SV=1
SEN15_YEAST25.899%1392.46e-08tRNA-splicing endonuclease subunit SEN15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN15 PE=1 SV=2
A0A1E4T9X1_9ASCO22.917%962.16e-07Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_124610 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0909

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 120 140 152

Detailed signature matches

  1. Domain IPR006677
    tRNA intron endonuclease, catalytic domain-like
    1. SSF53032 (tRNA-intr...)
  2. Domain IPR018593
    tRNA-splicing endonuclease subunit Sen15
    1. PF09631 (Sen15)

Protein sequence

>MIA_05757_1
MTTLNLSRKDLESESKYLADLVLKNLRYQQLWSKLATHTISLPLPSPTAQDSCYNFTIISGSPPEKLHHDDPSFTESQQY
TEWILPSVTEQTWSIREWVQVFDQVDALAHTLSNDDKSIFSTVKRMVMACQTNDGTVVYYMINRGITPPKRN

GO term prediction

Biological Process

GO:0006388 tRNA splicing, via endonucleolytic cleavage and ligation

Molecular Function

GO:0000213 tRNA-intron endonuclease activity

Cellular Component

None predicted.