Protein

MCA_00248_1

Length
158 amino acids

Browser: contigA:760725-761202-

RNA-seq: read pairs 445, FPKM 34.6, percentile rank 56.7% (100% = highest expression)

Protein function

KEGG:K15325SEN15 tRNA-splicing endonuclease subunit Sen15, fungi type
EGGNOG:0PR58SEN15Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body

Protein alignments

%idAln lengthE-value
MIA_05757_137.34%1586e-29MIA_05757_1
A0A0J9XBP1_GEOCN36.00%1503e-21Similar to Saccharomyces cerevisiae YMR059W SEN15 Subunit of the tRNA splicing endonuclease OS=Geotrichum candidum GN=BN980_GECA08s02100g PE=4 SV=1
UniRef50_A0A0J9XBP136.00%1506e-18Similar to Saccharomyces cerevisiae YMR059W SEN15 Subunit of the tRNA splicing endonuclease n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XBP1_GEOCN
Q6C7N9_YARLI27.70%1482e-18YALI0D26576p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D26576g PE=4 SV=1
A0A1E3PK49_9ASCO31.36%1693e-17Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51073 PE=4 SV=1
A0A167FU08_9ASCO29.66%1451e-15Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_3342 PE=4 SV=1
A0A060T8A5_BLAAD30.41%1483e-14ARAD1C27852p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C27852g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0819

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 120 140 158

Detailed signature matches

  1. Domain IPR006677
    tRNA intron endonuclease, catalytic domain-like
    1. SSF53032 (tRNA-intr...)
  2. Domain IPR018593
    tRNA-splicing endonuclease subunit Sen15
    1. PF09631 (Sen15)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_00248_1
MNSEEAKYAAQLVKENLIYQQLWTDINLFEIPFNSDEHTRGSLTLCYGKPPEKIFNDENNDSDETGYYRHEWVLPAMTNQ
DWSIAYWVQIFEEIDNLLAKASKHATQQRKVDETDSKESESKKSPKQAKRVIMACIDNDGTVVYYNVYRGIMPPRNNT

GO term prediction

Biological Process

GO:0006388 tRNA splicing, via endonucleolytic cleavage and ligation

Molecular Function

GO:0000213 tRNA-intron endonuclease activity

Cellular Component

None predicted.