Protein
MIA_05680_1
Length
308 amino acids
Browser: contig09:47447-48374+
Protein function
EGGNOG: | 0PHSW | RRP36 | Component of the 90S pre-ribosome involved in the maturation of rRNAs. Required for early cleavages of the pre-RNAs in the 40S ribosomal subunit maturation pathway (By similarity) |
---|---|---|---|
SGD closest match: | S000005813 | RRP36 | rRNA biogenesis protein RRP36 |
CGD closest match: | CAL0000179560 | RRP36 | rRNA biogenesis protein RRP36 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XCN1_GEOCN | 48.205% | 195 | 3.91e-51 | Similar to Saccharomyces cerevisiae YOR287C RRP36 Component of 90S preribosomes OS=Geotrichum candidum GN=BN980_GECA09s02595g PE=3 SV=1 |
UniRef50_A0A0J9XCN1 | 48.205% | 195 | 8.00e-48 | Similar to Saccharomyces cerevisiae YOR287C RRP36 Component of 90S preribosomes n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XCN1_GEOCN |
A0A167F3X3_9ASCO | 42.564% | 195 | 7.48e-41 | Rrp36p OS=Sugiyamaella lignohabitans GN=RRP36 PE=3 SV=1 |
MCA_06181_1 | 44.498% | 209 | 5.11e-36 | MCA_06181_1 |
RRP36_YARLI | 40.609% | 197 | 1.05e-34 | rRNA biogenesis protein RRP36 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP36 PE=3 SV=1 |
A0A1E3PJR5_9ASCO | 39.796% | 196 | 1.25e-30 | DUF947-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50952 PE=3 SV=1 |
A0A060T732_BLAAD | 41.837% | 196 | 2.19e-28 | ARAD1C25498p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C25498g PE=3 SV=1 |
RRP36_CANAL | 38.095% | 189 | 7.23e-28 | rRNA biogenesis protein RRP36 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP36 PE=3 SV=2 |
RRP36_YEAST | 33.511% | 188 | 5.72e-19 | rRNA biogenesis protein RRP36 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP36 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5205
Predicted cleavage: 39
Protein family membership
- rRNA biogenesis protein RRP36 (IPR009292)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_05680_1 MPPQKSSFKSGKPPQRSRDGRAHKKHKVRKLPSSLYDQDESEDEGVSGIEFGTLAKAQREMESKYAGGSSESEDEAPSED ETGGRDEEEERWGKKGRGARAKDAKHKRANKHAPSETSVRKRVSVVRDIPGLDPVRKGAGEGGEDIRFDTALGRADLTSA RRNYAFLDKYREDEVAALKEALREAEAAERANAAAAAEEDGDGEYVRLPTLGEREKRELKRKILSLEGTLRTMKARDFET SVVSKYKQEVKSGARQGPLHLKRSDARKLVLAEKYKVMKKKDIDRAVERKRKRNTARERKLMPEVRRG
GO term prediction
Biological Process
GO:0000469 cleavage involved in rRNA processing
Molecular Function
None predicted.
Cellular Component
None predicted.