Protein
MCA_06181_1
Length
327 amino acids
Gene name: RRP36
Description: rRNA biogenesis protein RRP36
Browser: contigD:3470643-3471627+
RNA-seq: read pairs 872, FPKM 32.8, percentile rank 55.2% (100% = highest expression)
Protein function
| Annotation: | RRP36 | rRNA biogenesis protein RRP36 | |
|---|---|---|---|
| KEGG: | K14795 | RRP36 | ribosomal RNA-processing protein 36 |
| EGGNOG: | 0PHSW | RRP36 | Component of the 90S pre-ribosome involved in the maturation of rRNAs. Required for early cleavages of the pre-RNAs in the 40S ribosomal subunit maturation pathway (By similarity) |
| SGD closest match: | S000005813 | RRP36 | rRNA biogenesis protein RRP36 |
| CGD closest match: | CAL0000179560 | RRP36 | rRNA biogenesis protein RRP36 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XCN1_GEOCN | 38.29% | 269 | 2e-41 | Similar to Saccharomyces cerevisiae YOR287C RRP36 Component of 90S preribosomes OS=Geotrichum candidum GN=BN980_GECA09s02595g PE=3 SV=1 |
| UniRef50_A0A0J9XCN1 | 38.29% | 269 | 4e-38 | Similar to Saccharomyces cerevisiae YOR287C RRP36 Component of 90S preribosomes n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XCN1_GEOCN |
| MIA_05680_1 | 39.35% | 277 | 2e-40 | MIA_05680_1 |
| A0A167F3X3_9ASCO | 34.77% | 279 | 2e-32 | Rrp36p OS=Sugiyamaella lignohabitans GN=RRP36 PE=3 SV=1 |
| A0A1E3PJR5_9ASCO | 35.82% | 268 | 1e-27 | DUF947-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50952 PE=3 SV=1 |
| A0A060T732_BLAAD | 39.45% | 218 | 8e-27 | ARAD1C25498p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C25498g PE=3 SV=1 |
| RRP36_CANAL | 32.22% | 270 | 2e-25 | rRNA biogenesis protein RRP36 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP36 PE=3 SV=2 |
| RRP36_YARLI | 33.96% | 212 | 5e-23 | rRNA biogenesis protein RRP36 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP36 PE=3 SV=1 |
| RRP36_YEAST | 30.09% | 216 | 1e-14 | rRNA biogenesis protein RRP36 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP36 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5079
Predicted cleavage: 23
Protein family membership
- rRNA biogenesis protein RRP36 (IPR009292)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_06181_1 MNRSTYNKNKHGSRSNSSNYRQKPQNKRSSYKKDFKRSSRNKYESDDDDDDDEEDMRDMSTVSFKTLNKAQEQIYESKND SNEASDDEPPSEDEMPTRSRGDQNSRKPDQTKRAHKHAPAESNRVHTRVSVVREIPGLAPSSASSSTPGSTLYQDIRFDT TYGKADLFQARKNYSFLDDYRKDEIEKMKQILKDNALLERKLHGKRDGENGEDDEDFEPPEDDDLSLPLLDSRQKAELKL NIQKLQSQLDTMTRRDFEHEAVTDYKRKVKTGELKGPLHLKRSQVKKLVLKSQYDKLKKSQVKKMLEKRRMRNAQKERKM MPLERRG
GO term prediction
Biological Process
GO:0000469 cleavage involved in rRNA processing
Molecular Function
None predicted.
Cellular Component
None predicted.