Protein

MIA_05659_1

Length
183 amino acids


Browser: contig08:1016855-1017569-

Protein function

EGGNOG:0PGCQTMA20Translation machinery-associated protein
SGD closest match:S000002957TMA20Translation machinery-associated protein 20
CGD closest match:CAL0000194613orf19.2920Translation machinery-associated protein 20

Protein alignments

%idAln lengthE-value
A0A0J9XGU9_GEOCN75.410%1839.09e-108Translation machinery-associated protein 20 OS=Geotrichum candidum GN=BN980_GECA16s00758g PE=3 SV=1
MCA_03273_176.503%1831.42e-105MCA_03273_1
A0A060T5G1_BLAAD73.481%1811.39e-100Translation machinery-associated protein 20 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C11924g PE=3 SV=1
A0A1E3PMD1_9ASCO65.746%1816.12e-90Translation machinery-associated protein 20 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_73694 PE=3 SV=1
TMA20_YEAST62.570%1791.29e-81Translation machinery-associated protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMA20 PE=1 SV=1
UniRef50_P8988662.570%1793.09e-78Translation machinery-associated protein 20 n=89 Tax=Eukaryota TaxID=2759 RepID=TMA20_YEAST
Q6CGQ0_YARLI59.551%1781.29e-80YALI0A17380p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A17380g PE=4 SV=1
Q5A199_CANAL60.541%1851.63e-79Translation machinery-associated protein 20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2920 PE=3 SV=1
A0A1E4TG68_9ASCO68.932%1031.65e-45Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_57186 PE=4 SV=1
A0A161HKH6_9ASCO71.212%661.33e-30Tma20p OS=Sugiyamaella lignohabitans GN=TMA20 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.7883

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 183

Detailed signature matches

    1. PIRSF005067 (Tma_RN...)
    1. SSF88697 (PUA domai...)
    1. PF01472 (PUA)
    2. PS50890 (PUA)
    3. SM00359 (pua_5)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd11609 (MCT1_N)

Residue annotation

  1. PUA domain interfa...

Protein sequence

>MIA_05659_1
MFKKFSREDINSRSNIKSSVQRTLKTRVSEQFPGFENLADEIVPKKSQLTQIKCSDRIYLYSVGPEVLFTQHDTDDIIPT
LNLVHKYPEILPSVRVDRGAIKFILGGANIMCPGLTSKGAQLPESPGLDKGQVVAVYAEGKVNALAIGRLTMSTEEIKSV
NKGIGVDLITYLGDGLWGLKDSV

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003723 RNA binding

Cellular Component

None predicted.