Protein
MIA_05648_1
Length
564 amino acids
Browser: contig08:1001110-1002915+
Protein function
EGGNOG: | 0PK46 | SRB4 | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity) |
---|---|---|---|
SGD closest match: | S000000824 | SRB4 | Mediator of RNA polymerase II transcription subunit 17 |
CGD closest match: | CAL0000197516 | SRB4 | Mediator of RNA polymerase II transcription subunit 17 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9X7P2_GEOCN | 45.743% | 505 | 1.17e-113 | Similar to Saccharomyces cerevisiae YER022W SRB4 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA05s02287g PE=4 SV=1 |
UniRef50_A0A0J9X7P2 | 45.743% | 505 | 2.39e-110 | Similar to Saccharomyces cerevisiae YER022W SRB4 Subunit of the RNA polymerase II mediator complex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X7P2_GEOCN |
A0A1E3PKB8_9ASCO | 42.735% | 468 | 8.95e-106 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51160 PE=4 SV=1 |
A0A060TDV7_BLAAD | 41.091% | 550 | 1.64e-101 | ARAD1D47080p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D47080g PE=4 SV=1 |
A0A167D505_9ASCO | 48.344% | 302 | 3.77e-79 | Srb4p OS=Sugiyamaella lignohabitans GN=SRB4 PE=4 SV=1 |
MED17_YARLI | 34.426% | 488 | 2.53e-66 | Mediator of RNA polymerase II transcription subunit 17 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SRB4 PE=3 SV=1 |
MCA_03322_1 | 40.089% | 449 | 1.50e-60 | MCA_03322_1 |
A0A1E4THI1_9ASCO | 35.439% | 285 | 2.46e-32 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2921 PE=4 SV=1 |
MED17_CANAL | 32.443% | 262 | 3.00e-29 | Mediator of RNA polymerase II transcription subunit 17 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SRB4 PE=3 SV=3 |
MED17_YEAST | 34.266% | 286 | 1.34e-27 | Mediator of RNA polymerase II transcription subunit 17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRB4 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0292
Protein family membership
- Mediator complex, subunit Med17 (IPR019313)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
Protein sequence
>MIA_05648_1 MTEITKDILISIEPKSKDESVSIDESSISLERLISWISQEKGSFANLSEDSLLEEIESSQKKDDIDGNGHIRSPVIDDIE IDGSPNQITNKSVQVMDEESFENARKELLLLIEIAQGESALSQDFVSLLMSGLKPASGTTSMSPYLKANVPNGSLNADTS KSMVTEDDPLVSAGWKLESLDNAANDLKAAAQKLNKETSKEVLYWKSILTIVSKGEILFKIRKSDLRDLSIKYGFDDSGS QYQDKGIAILKRENKGSLSFQTEVSKRTKVVKVTLFQILGGERVKVGVSSSICGVGLLSEEDENVEIDIKNARNLLFEEE LFHQMTMEARGLASHRVQVIDHKIIINLYDEILEIEYSDLNTKLDNGKSIKYSTRANYICAVFRILLSNLHRRNLQRRRQ LPVNITTNDSLKKAGVYILQPLIAHVLHEKIMKRTRKALELLVQNSLGEIDTNKPITIEQESVGLQSSGSFQSGRVYSHQ SAINNTLYLGRLGVQPASNITISVPEKFVIVVAVGSPLQWHSPLYSVVSYQWSSPDRIMSKSGFHDLSDLSDWIKWVFDS RQGN
GO term prediction
Biological Process
GO:0006357 regulation of transcription from RNA polymerase II promoter
Molecular Function
GO:0001104 RNA polymerase II transcription cofactor activity
Cellular Component
GO:0016592 mediator complex