Protein

MIA_05645_1

Length
368 amino acids


Browser: contig08:995933-997040+

Protein function

EGGNOG:0PG3VCWC2Involved in the first step of pre-mRNA splicing. Required for cell growth and cell cycle control. Plays a role in the levels of the U1, U4, U5 and U6 snRNAs and the maintenance of the U4 U6 snRNA complex. May provide the link between the nineteen complex NTC spliceosome protein complex and the spliceosome through the U6 snRNA. Associates predominantly with U6 snRNAs in assembled active spliceosomes. Binds directly to the internal stem-loop (ISL) domain of the U6 snRNA and to the pre- mRNA intron near the 5' splice site during the activation and catalytic phases of the spliceosome cycle
SGD closest match:S000002368CWC2Pre-mRNA-splicing factor CWC2
CGD closest match:CAL0000184865CWC2Pre-mRNA-splicing factor CWC2

Protein alignments

%idAln lengthE-value
A0A0J9X9J3_GEOCN55.769%3645.70e-140Similar to Saccharomyces cerevisiae YDL209C CWC2 Member of the NineTeen Complex (NTC) that contains Prp19p and stabilizes U6 snRNA in catalytic forms of the spliceosome containing U2, U5, and U6 snRNA OS=Geotrichum candidum GN=BN980_GECA05s02254g PE=4 SV=1
A0A060TCZ8_BLAAD55.491%3461.03e-137ARAD1D46970p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D46970g PE=4 SV=1
A0A1E3PM35_9ASCO66.667%2465.53e-128Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46487 PE=4 SV=1
UniRef50_A0A1E3PM3566.667%2461.50e-124Uncharacterized protein n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PM35_9ASCO
CWC2_YARLI60.985%2641.53e-122Pre-mRNA-splicing factor CWC2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CWC2 PE=3 SV=1
MCA_03325_155.389%3341.54e-120MCA_03325_1
A0A1E4TC76_9ASCO60.619%2264.77e-106Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3878 PE=4 SV=1
A0A161HIT2_9ASCO72.483%1495.73e-74Cwc2p OS=Sugiyamaella lignohabitans GN=CWC2 PE=4 SV=1
CWC2_CANAL46.809%2353.21e-64Pre-mRNA-splicing factor CWC2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CWC2 PE=3 SV=1
CWC2_YEAST39.485%2335.44e-50Pre-mRNA-splicing factor CWC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWC2 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0062

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 368

Detailed signature matches

    1. SSF90229 (CCCH zinc...)
    2. PS50103 (ZF_C3H1)
    1. PF16131 (Torus)
    1. SSF54928 (RNA-bindi...)
    2. PS50102 (RRM)
    3. SM00360 (rrm1_1)
    4. PF00076 (RRM_1)
    1. cd12360 (RRM_cwf2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_05645_1
MSSNSDLAVEPEGPSKKDESSSKVLDNTTPKKLKKKKLRPARIQKPPGTVDDQPPQTGTVFNIWYLKWSGGDKEDGMYNQ
RKADSRCVLSTDSGYTKADEIPGSYICLYFARGMCSKGKNCDYLHRLPTEYDVYSQNVDCFGRDKFADYRDDMGGVGSFL
RQTRTLYVGRINSSENVEDVVSRHFQEWGKIERIRVLNNRGVAFVTYSNEANSEFAKEAMAHQSLDNNEVLNVRWATEDP
NPLAQAREKRRIEEQAADAIRKFLPKDLINEVESTGLASKRKKISAGNKELENQKTVDRQNIHKTIEESPHNSPLGQVTP
IMNSQINENEDTQKVGLFSAKTLEGIKSLYSKDKPPVTTSIVADYDSE

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0046872 metal ion binding

Cellular Component

None predicted.