Protein

MIA_05601_1

Length
484 amino acids


Browser: contig08:904289-905744-

Protein function

EGGNOG:0PIAFMDM34Component of the ERMES MDM complex, which serves as a molecular tether to connect the endoplasmic reticulum and mitochondria. Components of this complex are involved in the control of mitochondrial shape and protein biogenesis and may function in phospholipid exchange. mdm34 is required for the interaction of the ER-resident membrane protein mmm1 and the outer mitochondrial membrane-resident beta-barrel protein mdm10 (By similarity)

Protein alignments

%idAln lengthE-value
A0A0J9XIV6_GEOCN30.742%2831.63e-17Similar to Saccharomyces cerevisiae YGL219C MDM34 Mitochondrial component of the ERMES complex that links the ER to mitochondria OS=Geotrichum candidum GN=BN980_GECA22s01110g PE=4 SV=1
UniRef50_A0A0J9XIV630.742%2833.34e-14Similar to Saccharomyces cerevisiae YGL219C MDM34 Mitochondrial component of the ERMES complex that links the ER to mitochondria n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XIV6_GEOCN
MCA_03722_128.796%1914.82e-11MCA_03722_1
A0A060SYR5_BLAAD30.672%2385.71e-11Mitochondrial distribution and morphology protein 34 OS=Blastobotrys adeninivorans GN=MDM34 PE=3 SV=1
A0A1E3PR98_9ASCO30.612%1961.48e-10Mitochondrial distribution and morphology protein 34 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=MDM34 PE=3 SV=1
MDM34_YARLI29.474%1902.55e-10Mitochondrial distribution and morphology protein 34 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDM34 PE=3 SV=1
A0A167ETG5_9ASCO28.163%2451.38e-08Mitochondrial distribution and morphology protein 34 OS=Sugiyamaella lignohabitans GN=MDM34 PE=3 SV=1
A0A1E4TDK4_9ASCO29.319%1916.32e-07Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13309 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0275

Protein family membership

None predicted.

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_05601_1
MSFTFSWDPTLVNDSNFAQIKAAIDAALARGPAPAGVAGPVVLERLYLGDTPPSIHIQAVEDVASDRVKAVFAMQYAGNA
SIALRTLVQANLLRGVLLDEDGQQDVHPQSLKPGVEPHAADNDPTNGSCSSSCYFNWPPPLRPSLTLALPHALGALAPLA
LPLEFTIHDLRLSGTVSLVATKNKGIVMVFDGDPLQSLELSSSLDDLPSVSAQLKREVEIEIREVLRDTIPQVVYQITSN
TAAPSPPSTKNEIPIPSIADPKHAPPPIFDFPFLATSALTKIKSLAQSTATLAALSSPSPIINKKSIRPDRLFLSVPQPP
PPDSPSNTITATNTPPLIIDFDALSDTDSDVSASLTALLPPPSQPVSPRPHARRVINLRHVLRPPPSSAPTVIPRPSSKP
LAISSRSLSPPRPHIDQFRMAPHNPAMVSPANRPKRGSDPRRVVSGNISTGRLDSGGAMASKTQGQGDPAPLSNSTRYFL
TQQR

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.