Protein
MIA_05601_1
Length
484 amino acids
Browser: contig08:904289-905744-
Protein function
| EGGNOG: | 0PIAF | MDM34 | Component of the ERMES MDM complex, which serves as a molecular tether to connect the endoplasmic reticulum and mitochondria. Components of this complex are involved in the control of mitochondrial shape and protein biogenesis and may function in phospholipid exchange. mdm34 is required for the interaction of the ER-resident membrane protein mmm1 and the outer mitochondrial membrane-resident beta-barrel protein mdm10 (By similarity) |
|---|
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XIV6_GEOCN | 30.742% | 283 | 1.63e-17 | Similar to Saccharomyces cerevisiae YGL219C MDM34 Mitochondrial component of the ERMES complex that links the ER to mitochondria OS=Geotrichum candidum GN=BN980_GECA22s01110g PE=4 SV=1 |
| UniRef50_A0A0J9XIV6 | 30.742% | 283 | 3.34e-14 | Similar to Saccharomyces cerevisiae YGL219C MDM34 Mitochondrial component of the ERMES complex that links the ER to mitochondria n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XIV6_GEOCN |
| MCA_03722_1 | 28.796% | 191 | 4.82e-11 | MCA_03722_1 |
| A0A060SYR5_BLAAD | 30.672% | 238 | 5.71e-11 | Mitochondrial distribution and morphology protein 34 OS=Blastobotrys adeninivorans GN=MDM34 PE=3 SV=1 |
| A0A1E3PR98_9ASCO | 30.612% | 196 | 1.48e-10 | Mitochondrial distribution and morphology protein 34 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=MDM34 PE=3 SV=1 |
| MDM34_YARLI | 29.474% | 190 | 2.55e-10 | Mitochondrial distribution and morphology protein 34 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDM34 PE=3 SV=1 |
| A0A167ETG5_9ASCO | 28.163% | 245 | 1.38e-08 | Mitochondrial distribution and morphology protein 34 OS=Sugiyamaella lignohabitans GN=MDM34 PE=3 SV=1 |
| A0A1E4TDK4_9ASCO | 29.319% | 191 | 6.32e-07 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13309 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0275
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_05601_1 MSFTFSWDPTLVNDSNFAQIKAAIDAALARGPAPAGVAGPVVLERLYLGDTPPSIHIQAVEDVASDRVKAVFAMQYAGNA SIALRTLVQANLLRGVLLDEDGQQDVHPQSLKPGVEPHAADNDPTNGSCSSSCYFNWPPPLRPSLTLALPHALGALAPLA LPLEFTIHDLRLSGTVSLVATKNKGIVMVFDGDPLQSLELSSSLDDLPSVSAQLKREVEIEIREVLRDTIPQVVYQITSN TAAPSPPSTKNEIPIPSIADPKHAPPPIFDFPFLATSALTKIKSLAQSTATLAALSSPSPIINKKSIRPDRLFLSVPQPP PPDSPSNTITATNTPPLIIDFDALSDTDSDVSASLTALLPPPSQPVSPRPHARRVINLRHVLRPPPSSAPTVIPRPSSKP LAISSRSLSPPRPHIDQFRMAPHNPAMVSPANRPKRGSDPRRVVSGNISTGRLDSGGAMASKTQGQGDPAPLSNSTRYFL TQQR
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.